Details for Chinese cabbage Locus Brara.A02975

Position : A01 ( 5`- 25299200 .. 25301288 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02975

Protein [Map View]
MASMSFAATRFSGLSSKTTLSPDFDHSPRRTSLPPNRVALKISSSTDSEPDLSVTVNGLKMPNPFVIGSGPPGTNYTVMK
RAFDEGWGGVIAKTVSLDASKVINVTPRYARLRTGSAKTDVIGWQNIELISDRPLETMLKEFKQLKQEYPDRILIASIME
EYSKTGWEELIDRVEQTGVDALEINFSCPHGMPERRMGAAVGQDCALLEEVCGWINAKATVPVWAKMTPNITDITEPARV
SLKSGCEGISAINTIMSVMGINLKTLHPEPCVEGYSTPGGYSYKAVRPIALAKVMNIAQMMKSEFGEKDCSLSGIGGVET
GYDAAEFILLGSNTVQVCTGVMVHGYGHVKTLCADLQDFMRQHNFSTIEDFRGHSLQYFTTHTDLVRRQKEAIEQRKAER
RGLKSDKDWTGDGFVKETESMVSN*

DNA
ATGGCATCCATGAGCTTCGCCGCGACTCGCTTCTCCGGACTCTCTTCTAAAACCACCTTATCACCCGACTTCGATCACTC
CCCTCGCCGGACTTCTCTACCTCCGAACAGAGTTGCTCTCAAGATCTCTTCCTCCACGGACTCGGAGCCTGATCTCAGCG
TCACCGTGAATGGCCTCAAAATGCCGAATCCTTTCGTGATCGGGTCGGGTCCACCCGGTACCAACTACACCGTCATGAAG
AGAGCCTTCGACGAAGGCTGGGGTGGCGTCATCGCTAAAACCGTGTCACTAGACGCATCCAAAGTCATAAACGTGACGCC
TAGGTACGCCAGGCTACGAACCGGGTCAGCCAAAACAGATGTAATCGGGTGGCAGAACATAGAACTCATCAGCGACCGAC
CTCTCGAAACCATGCTCAAAGAGTTCAAGCAGCTGAAACAAGAGTACCCTGACCGGATCCTCATCGCTTCCATCATGGAG
GAATACAGCAAAACCGGCTGGGAAGAGCTCATCGACCGCGTCGAGCAAACCGGCGTCGATGCTTTAGAGATCAACTTCTC
GTGTCCTCATGGTATGCCAGAGCGTAGAATGGGAGCTGCTGTTGGACAAGACTGCGCGCTTCTTGAAGAGGTTTGTGGAT
GGATTAATGCGAAAGCCACAGTTCCTGTGTGGGCCAAGATGACTCCTAATATTACTGACATAACAGAGCCGGCCAGGGTA
TCTCTAAAATCAGGATGTGAAGGGATCTCAGCCATCAACACAATCATGAGTGTGATGGGAATTAATCTGAAGACGTTGCA
TCCTGAGCCTTGCGTTGAAGGTTACTCAACTCCAGGAGGCTACTCTTATAAGGCTGTTCGTCCTATTGCGCTTGCGAAAG
TTATGAACATTGCCCAAATGATGAAGTCTGAGTTCGGTGAGAAAGATTGTTCGCTTTCTGGTATTGGAGGTGTTGAAACT
GGCTATGACGCAGCTGAGTTCATTCTCCTTGGATCTAATACTGTACAGGTGTGCACAGGTGTGATGGTGCATGGCTATGG
TCATGTGAAAACTCTATGCGCCGACCTTCAAGATTTCATGAGGCAGCACAACTTCTCGACGATAGAAGACTTCAGAGGGC
ATTCGCTTCAGTACTTTACAACGCACACTGACTTAGTAAGGAGACAGAAAGAAGCTATTGAGCAGAGAAAAGCTGAGAGG
AGAGGCTTGAAATCTGATAAAGATTGGACTGGAGATGGATTCGTTAAGGAGACTGAGAGTATGGTTTCTAACTAA