Details for Chinese cabbage Locus Brara.A02972

Position : A01 ( 5`- 25281853 .. 25284386 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02972

Protein [Map View]
MACSLSTFLSTLLLLSLPLPSTQDLAADKSALLSLRSAVGGRTFLWNTEQTTPCNWTGVACDGANRVTALRLPGFALSGN
IPEGIFGNLTNLRTLSLRLNALTGSLPLDLGACADLRRLYLQGNRFSGEIPPLLFGLSNLVRLDLGENEFTGEISSGFKN
LTRLKTLYLENNKLSGSLLDLGLGLGLGLGLDQFNVSNNSLNGSIPKSLQKFDSDSFLGTSLCGKPLGACSDEGTVPSQP
ISVGNIPGKRKSKLSGGAIAGIVIGCVVGFLLIVLVLMVLFRRKGDERTRAVDVETIKQLEIEVPGEKTAVEANEPSTAA
VNSSGTRKLVFFGNATKVFELEDLLRASAEVLGKGTFGTAYKAVLDAATLVAVKRLKDVTMADREFKEKIEVVGAMDHEN
LVPLRAYYCSGDEKLLVPVMVEVVRRIQELRQPGSELVD*

DNA
ATGGCGTGTAGTCTCTCCACATTCCTCTCGACTCTCCTCCTCCTCTCTCTCCCTCTCCCCTCAACACAAGACCTCGCCGC
CGACAAATCCGCCCTCCTCTCCCTCCGCTCCGCCGTCGGAGGCCGCACATTCCTCTGGAACACCGAACAAACCACACCAT
GCAACTGGACCGGCGTCGCTTGCGACGGCGCCAACCGCGTAACCGCCCTCCGCCTCCCCGGCTTCGCCCTCTCCGGCAAC
ATCCCCGAGGGTATTTTCGGAAACTTAACAAATCTCCGCACCCTCAGCCTCCGCCTCAACGCGCTCACCGGAAGCCTCCC
CTTAGATCTCGGCGCCTGCGCCGACCTCCGGCGACTCTACCTCCAAGGAAACAGATTCTCCGGCGAGATTCCACCACTCT
TGTTCGGTCTCAGCAACCTCGTGAGGCTGGATCTTGGGGAGAACGAGTTCACGGGAGAGATCTCCTCAGGGTTCAAGAAC
CTCACGAGGCTTAAGACTCTCTACTTGGAGAACAACAAGCTCTCCGGCTCTCTTCTCGATTTGGGCTTGGGCTTGGGCTT
GGGCTTGGGCCTGGATCAGTTCAACGTCTCTAACAACTCCTTGAACGGATCTATACCGAAGAGTCTTCAGAAGTTTGATT
CTGATTCTTTTCTCGGGACTTCGCTCTGTGGAAAGCCGCTTGGTGCTTGTAGTGATGAAGGAACTGTGCCGAGTCAGCCT
ATTTCCGTCGGAAACATTCCCGGGAAGAGAAAGAGCAAACTCTCCGGCGGAGCTATTGCCGGAATAGTGATTGGTTGCGT
GGTTGGCTTCCTCCTGATCGTTCTTGTTTTGATGGTTCTCTTCCGGAGAAAGGGAGACGAGAGAACAAGAGCCGTCGACG
TTGAAACCATCAAGCAGCTTGAGATCGAAGTTCCCGGCGAGAAAACGGCGGTGGAAGCAAACGAGCCATCCACGGCGGCG
GTGAACAGCTCAGGGACGAGGAAGTTAGTCTTCTTTGGGAACGCGACGAAGGTTTTCGAGCTAGAGGATCTGCTGAGAGC
TTCTGCGGAGGTTCTTGGGAAGGGAACGTTCGGGACGGCGTACAAGGCGGTGCTTGACGCGGCGACGTTGGTGGCGGTGA
AGAGGCTGAAGGATGTGACGATGGCGGATAGAGAGTTCAAGGAGAAGATTGAGGTTGTTGGGGCGATGGATCATGAGAAC
TTGGTGCCGCTGAGAGCTTATTATTGCAGTGGAGACGAGAAGCTGCTTGTGCCAGTGATGGTGGAGGTGGTGAGGAGGAT
CCAGGAGTTGCGCCAGCCGGGTTCGGAGCTGGTGGACTAG