Details for Chinese cabbage Locus Brara.A02969

Position : A01 ( 5`- 25231454 .. 25234642 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02969

Protein [Map View]
MERDFLGLGSKNSPITVKEETSESSRDSAPSRGMKWSFPNKASATSSPQFLTFRPSQENRHRNLGNYHLPHSGSFMPSSV
ADVYDSSYRSTPYSSVQGVRMFPSSKQHEEAISVSMSRPSLQSHYASGGTSFINNSVNSQPLVGVPIMAPPVSVLPPPGS
IVGTTDIRCSSKPSGSSPAQLTIFYAGSVCVYNDISPEKAKAIMLLAGNGSPMPQVFSPPQTHQQVVHHARASVDSSAMP
PSFMPTVSYLSPEAGSSSNGFGAAKAARDFTTTYLSNQTNASNINSSVAASCSANVPQTGKIVALPQARKASIARFLEKR
KERVTSLSPYCLDKKSSTDCRTPMSECISSSLSSAT*

DNA
ATGGAGAGAGATTTTCTCGGGCTGGGTTCAAAAAATTCACCGATCACTGTGAAGGAGGAAACCAGTGAAAGCTCCAGAGA
TTCAGCCCCGAGTAGAGGAATGAAGTGGTCATTCCCAAACAAAGCCTCTGCTACTTCTTCTCCTCAGTTTCTAACTTTCA
GGCCATCCCAAGAAAACAGACATAGAAACCTTGGAAACTATCATCTGCCACACTCTGGTTCCTTCATGCCATCATCCGTA
GCTGATGTTTATGATTCCTCCTACCGGAGCACTCCTTACAGTTCTGTTCAGGGAGTTAGGATGTTCCCTAGTTCCAAACA
ACATGAAGAAGCTATCTCAGTTTCCATGTCTAGGCCGAGTCTCCAGTCTCATTATGCATCAGGAGGAACAAGCTTCATCA
ACAATAGCGTAAACTCGCAACCTTTGGTAGGAGTTCCTATCATGGCACCTCCAGTATCAGTCCTTCCTCCTCCAGGTTCC
ATTGTTGGGACAACTGATATTAGATGTTCTTCCAAGCCATCAGGATCATCACCTGCTCAGTTGACCATCTTTTATGCCGG
TTCAGTTTGTGTTTATAATGACATATCTCCTGAAAAGGCCAAGGCGATAATGTTACTTGCTGGAAACGGTTCCCCTATGC
CACAAGTCTTTTCACCACCACAAACTCATCAACAAGTGGTCCATCATGCTCGTGCCTCCGTTGATTCTTCAGCTATGCCT
CCTAGCTTCATGCCCACAGTCTCTTATCTCAGCCCTGAAGCTGGAAGTAGCTCAAATGGGTTCGGAGCAGCTAAAGCAGC
AAGAGACTTTACAACAACATACCTCAGCAACCAAACTAACGCATCCAATATCAACTCTTCAGTGGCAGCTTCTTGTTCTG
CCAATGTACCTCAAACAGGTAAAATAGTGGCTTTACCTCAGGCTCGGAAAGCATCTATAGCTAGATTCTTAGAGAAACGC
AAAGAAAGGGTCACAAGCCTATCGCCATATTGCTTAGACAAGAAGTCATCAACAGATTGTCGCACACCAATGTCTGAATG
CATAAGTTCTTCTCTCAGCTCTGCAACCTAA