Details for Chinese cabbage Locus Brara.A02968

Position : A01 ( 5`- 25225039 .. 25229139 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02968

Protein [Map View]
MNFLLRSASSATHRPPVSEPPPPTPLPQPPPEATLERAEEPFPQYPSLEDHLDRSGDDHGNGESNANTDVSGIDRFSDVS
EEEGWISIPYKEIPDNWSESVDIQSLRSLDRSFVFPGEQIQILACLSDSKVATEIITPFKVAEVMSRTVNRKASHKQNGD
ISDGESYESIPLGNPDGHFAAQNGHKDGESILRMEDHKRRTEDLLSRFQESHFFVRIAESGEPLWSKKSSMASEGDEKRT
CVSAFVDRGEFDPDVAGGVARSRAKCCALPNGDIVVSLQVYIVDCPKEPVIEILQFEKHQDRDPLSDSDHEHKDPYGNLL
KWLIPLDNNISQQPRSLPPPISSSPGLSSSAHKPALSSASSSQLFSFGHFRSYSMSSLPPNTAPVTGSVKTQSSKPSFDI
EDWDSYSAQTLRNGQKPGTEELLSFRGVPLERDRFSVRCGLEGICVPGRRWRRKLEIIQPIEINSFAADCNTDDLLCVQI
KNVAPTHTPDIVIYVDAITIVFEEAGKSASPSSVPIACIEAGNEHSLPNLTLRKGEEHSFIVRPAFSVGSNVKPSAARKE
LKASSLSLPSVNFERKGSGLSGDQYAVMVSCRCNYTESRLFFKQRTKWRPRVSKDLMISVASEMSGEPCGPHGRASQLPV
QILTLQASNLTPEDLSLTVLAPASFTSPPSVVSLNSTPTSPVSPFLGFSEFTERVQSEKRNTTARRKVQSLPSMPLETTR
TETATNDEMNSASSNNPSDVVPKSGLGCTHLWLQSRVPLGCVPSKSTATIKVELLPLTDGIITLDTLQVHVKEKGRRYIP
DQSLKINATSSISSGMF*

DNA
ATGAATTTCTTGCTCCGATCTGCTTCCTCCGCTACTCATCGTCCCCCGGTGAGCGAACCACCACCACCTACACCGCTTCC
TCAACCTCCGCCTGAAGCAACTTTGGAAAGAGCCGAAGAGCCTTTCCCACAGTATCCATCCCTAGAGGATCATTTAGATA
GATCTGGAGACGACCATGGAAATGGAGAGTCAAATGCAAACACAGATGTCTCTGGTATCGACAGATTCTCAGATGTATCT
GAGGAAGAAGGATGGATCTCAATTCCATATAAGGAGATCCCTGACAACTGGTCGGAATCAGTTGATATTCAGTCACTACG
GTCCCTAGATCGCTCCTTTGTGTTTCCTGGGGAACAGATTCAAATCCTAGCATGCTTATCCGACAGTAAAGTAGCCACAG
AGATCATCACTCCTTTCAAAGTGGCCGAGGTGATGAGCAGAACTGTAAACAGAAAAGCCTCTCACAAACAAAACGGAGAT
ATCTCTGACGGGGAGAGTTACGAGAGTATACCATTAGGGAACCCTGACGGCCATTTCGCAGCTCAGAACGGGCACAAAGA
TGGTGAATCGATCTTGAGGATGGAAGATCACAAGAGACGGACGGAAGACTTGCTTTCCAGGTTTCAGGAGTCTCATTTCT
TCGTTAGGATTGCTGAGTCTGGCGAGCCTCTTTGGTCTAAGAAAAGCTCTATGGCCTCAGAGGGAGATGAAAAGAGAACT
TGTGTTAGTGCTTTCGTGGATAGAGGGGAGTTTGATCCTGATGTTGCTGGAGGTGTAGCTAGGAGTAGAGCTAAATGCTG
CGCCTTACCCAATGGAGACATAGTGGTCTCTTTACAAGTTTACATCGTTGACTGTCCCAAAGAACCAGTCATTGAGATAC
TGCAGTTTGAGAAGCATCAGGACAGGGACCCACTTTCTGACTCGGATCATGAACACAAGGATCCATATGGGAATCTCTTA
AAGTGGTTGATACCATTGGATAACAATATTTCTCAGCAACCACGTTCTTTGCCACCTCCTATAAGCTCTAGCCCAGGTCT
CAGCAGCAGTGCACACAAGCCAGCGCTCTCTTCCGCCTCAAGCTCTCAGCTCTTCTCGTTCGGCCATTTTAGAAGCTACT
CCATGTCTTCTCTGCCGCCGAACACTGCACCGGTTACCGGATCAGTGAAAACACAGAGCTCTAAACCATCGTTTGACATT
GAAGACTGGGACAGTTACTCAGCTCAAACGTTAAGAAACGGTCAGAAGCCTGGGACTGAAGAGCTCTTATCTTTCCGGGG
TGTTCCCTTGGAGCGTGATAGGTTCTCTGTTCGCTGTGGACTGGAAGGCATCTGCGTTCCCGGCAGGAGGTGGAGGAGGA
AACTCGAAATCATTCAGCCTATTGAGATCAATTCTTTTGCAGCTGACTGCAATACAGATGACCTTCTCTGCGTTCAGATT
AAGAATGTTGCTCCTACACACACTCCAGATATTGTAATATACGTTGACGCAATAACGATTGTTTTTGAAGAGGCGGGGAA
GAGTGCTTCTCCTTCTTCAGTACCAATTGCATGTATTGAAGCTGGAAACGAGCATAGTTTGCCGAATTTGACTCTCAGGA
AAGGTGAGGAGCACTCATTCATCGTGAGACCTGCCTTTTCTGTTGGGAGTAATGTCAAACCCTCTGCTGCAAGAAAAGAA
CTCAAAGCATCGAGTTTGTCTCTTCCGTCTGTAAATTTTGAGAGAAAAGGGAGCGGTTTAAGTGGTGATCAGTATGCGGT
TATGGTGTCGTGTCGATGCAACTACACAGAATCAAGGCTGTTTTTCAAACAGCGGACAAAGTGGAGACCACGAGTTTCGA
AGGATCTGATGATCTCTGTTGCTTCTGAAATGTCAGGAGAGCCTTGTGGCCCCCATGGGAGAGCCTCCCAGCTACCTGTT
CAGATATTAACTCTTCAGGCATCAAACTTGACACCTGAAGATCTGTCATTAACGGTTCTCGCTCCAGCATCCTTCACATC
ACCTCCATCTGTGGTCTCCCTAAACTCCACGCCTACCTCTCCTGTAAGCCCATTCCTAGGGTTCTCCGAGTTCACAGAGA
GGGTACAAAGCGAGAAACGTAACACAACAGCAAGGCGTAAAGTGCAATCGTTACCCTCAATGCCACTGGAGACGACAAGG
ACAGAGACAGCAACAAATGACGAAATGAACTCTGCTTCTTCCAACAACCCTTCAGATGTTGTTCCGAAGAGCGGCTTAGG
GTGTACACATCTCTGGCTACAAAGTCGAGTTCCCTTGGGATGCGTTCCTTCGAAATCTACAGCGACGATCAAGGTAGAGC
TACTCCCTTTGACTGACGGCATAATCACTCTTGACACTCTCCAAGTCCACGTCAAGGAGAAAGGTCGTAGGTACATACCG
GATCAGTCACTGAAGATAAACGCAACGTCAAGCATTTCCTCTGGAATGTTTTAG