Details for Chinese cabbage Locus Brara.A02965

Position : A01 ( 5`- 25215074 .. 25216934 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02965

Protein [Map View]
MADQSKNNTPEIFELNNGSMHVKISNYGATITSLFVPDKNGKSADVVLGFDSVDPYVKGLAPYFGCIVGRVANRIKEGKF
SLNGVDYTLPINKPPNSLHGGSKGFDKKIWDVAGHKKDGDKPFIIFKYHSADGEEGYPGAVAVTATYTLTSATTMRLDME
AVPENKDTPISLAQHTYWNLAGHDSGNILDHRIQIWGSHVTPVDQFTVPTGEILPVKGTPFDFTEEKRIGESIGEVGLGY
DHNYVLDCPDQEKEGLKHAAKLRDGASSRILDLWTNAPGMQFYTGNYVNGVVGKGNAVYGKHAGVCLETQGFPNAINQLN
FPSVVVKAGEKYKHTMLFEFSV*

DNA
ATGGCAGATCAGAGCAAGAACAACACTCCTGAGATCTTCGAGCTCAACAATGGATCAATGCATGTCAAGATCTCAAATTA
TGGTGCCACCATCACCTCCTTGTTTGTCCCCGACAAGAACGGGAAATCGGCTGATGTAGTTCTCGGATTCGACTCCGTGG
ATCCGTACGTGAAAGGCCTTGCACCCTACTTTGGGTGCATAGTTGGTCGTGTAGCAAATCGGATCAAAGAGGGCAAGTTT
AGTCTCAATGGAGTCGACTACACTCTTCCCATCAACAAGCCTCCCAACAGCCTCCACGGTGGTAGCAAAGGTTTCGATAA
GAAGATATGGGACGTTGCTGGACACAAGAAAGACGGTGATAAACCTTTCATCATTTTCAAATATCACAGCGCCGATGGAG
AAGAAGGTTACCCGGGTGCGGTTGCTGTCACAGCGACTTACACTCTCACGTCAGCGACGACCATGAGACTTGACATGGAG
GCCGTTCCTGAGAACAAAGACACTCCCATCAGCTTAGCTCAGCATACATACTGGAACTTAGCGGGTCACGACTCAGGAAA
CATTCTTGACCACAGGATCCAGATTTGGGGGTCTCATGTCACTCCTGTGGATCAGTTCACAGTTCCTACAGGGGAGATTT
TACCGGTTAAGGGAACTCCTTTCGATTTCACCGAGGAGAAACGTATAGGCGAGTCTATTGGAGAGGTGGGTTTAGGATAC
GACCACAACTACGTGTTGGACTGTCCTGATCAAGAGAAGGAGGGGCTGAAACACGCGGCGAAGCTGAGAGACGGTGCGAG
CTCGAGGATACTTGACTTGTGGACCAATGCTCCGGGAATGCAGTTTTATACGGGGAACTATGTGAATGGAGTGGTTGGGA
AAGGGAATGCGGTTTATGGGAAGCATGCAGGTGTGTGCCTTGAGACGCAAGGCTTCCCGAACGCGATTAACCAGCTGAAT
TTCCCGTCTGTTGTGGTTAAGGCTGGTGAGAAGTACAAGCACACGATGCTGTTTGAGTTTTCAGTTTGA