Details for Chinese cabbage Locus Brara.A02955

Position : A01 ( 5`- 25164069 .. 25165497 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02955

Protein [Map View]
MAEGLVLKGTMRAHTDMVTAIATPIDNSDIIVTSSRDKSIILWKLTKDEKSYGVAQRRLTGHSHFVEDVVLSSDGQFALS
GSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKLWNTLGECKYTISEADGHKDWISCVRFSPN
TLVPTIVSASWDKTVKVWNLQNCKLKSSLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEGGSIIHSL
CFSPNRYWLCAATESSIKIWDLESKSVVDELKVDLKAEAEKCDGGVGTGNQKKVNYCTSLNWSADGSTLFSGYTDGVVRV
WGIGRY*

DNA
ATGGCCGAGGGACTCGTACTCAAGGGCACAATGCGCGCCCACACCGACATGGTCACCGCCATCGCCACGCCGATCGACAA
CTCCGACATCATCGTCACATCGTCCCGCGACAAATCCATCATCCTCTGGAAACTCACCAAGGACGAAAAATCCTACGGCG
TCGCGCAGCGCCGCCTCACAGGCCACTCTCACTTCGTCGAGGACGTGGTCCTCTCCTCCGACGGGCAGTTCGCCCTCTCC
GGAAGCTGGGACGGCGAGCTCCGTCTCTGGGACCTGGCCACCGGCGTCTCCACTCGCAGATTCGTGGGACACACGAAAGA
CGTCCTCTCCGTGGCCTTCTCCGTTGACAACCGTCAGATCGTCTCCGCCTCTCGTGACCGTACGATCAAGCTCTGGAACA
CGCTCGGTGAGTGTAAGTACACGATCTCGGAAGCTGATGGTCATAAGGATTGGATTAGCTGTGTGAGGTTTAGCCCCAAC
ACGCTTGTCCCCACCATTGTCTCCGCGTCGTGGGATAAGACCGTGAAGGTGTGGAATTTGCAGAACTGTAAGCTGAAGAG
CTCGCTCGCGGGGCACTCTGGTTACCTCAACACTGTGGCGGTTTCGCCTGATGGTTCTTTGTGTGCGAGTGGCGGGAAAG
ACGGTGTGATATTGTTGTGGGATTTGGCTGAGGGGAAGAAGTTGTATTCTCTTGAGGGTGGATCGATTATTCACTCGCTT
TGTTTCAGTCCGAATAGGTACTGGCTGTGTGCTGCGACGGAGAGTAGTATTAAGATTTGGGATCTTGAGAGTAAGAGTGT
TGTTGATGAGTTGAAGGTTGATCTTAAGGCTGAGGCTGAGAAGTGTGATGGTGGTGTCGGAACTGGTAACCAGAAGAAGG
TGAACTACTGCACAAGCTTGAACTGGAGTGCAGATGGAAGCACATTGTTCAGTGGTTACACTGATGGAGTTGTCAGGGTC
TGGGGTATTGGTCGTTACTAG