Details for Chinese cabbage Locus Brara.A02952

Position : A01 ( 5`- 25150597 .. 25152586 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02952

Protein [Map View]
MATNNGDVLMLEAAPEASKPWASAANAEVIDALPYIDDDYGNPLIKAEVDRLVEEEMRRSSRKPADFLKELPPLPKFDFE
NCPVLGKEYERVRAGKPPVRIDFESRYKVELPPASKKNDDAAWKQYLQKNQRSLQQKMIELENLEMMSKQGPELWRQNNH
RLEVLLTRMQKLAQEQNEEIEKVNRERKYHQQTTAYELNALSQEWRQLCVKNMEIQSACVVLETKIDAFKKEAAERGWNL
EEKLESVKPLQPQ*

DNA
ATGGCGACGAACAATGGAGACGTCTTGATGCTAGAGGCAGCGCCGGAAGCTTCAAAGCCGTGGGCGAGCGCGGCGAACGC
AGAAGTCATCGACGCGCTTCCTTATATCGACGACGACTATGGCAATCCACTGATTAAGGCGGAGGTCGACCGCTTGGTGG
AGGAAGAGATGCGTCGGAGCTCAAGGAAGCCTGCTGACTTTCTCAAGGAGTTGCCTCCTCTTCCCAAGTTCGATTTCGAG
AACTGCCCCGTTCTTGGCAAAGAGTATGAGCGTGTTCGAGCTGGGAAGCCTCCAGTGCGGATAGATTTTGAGTCCCGGTA
CAAGGTTGAACTGCCGCCTGCGAGTAAGAAAAACGATGATGCTGCCTGGAAGCAGTATCTTCAGAAGAATCAACGGTCAT
TGCAACAGAAGATGATCGAGCTTGAGAATTTGGAAATGATGTCTAAGCAAGGCCCCGAGCTTTGGAGACAGAACAACCAT
CGGCTTGAAGTACTCTTGACCAGAATGCAAAAACTAGCTCAGGAGCAGAACGAAGAAATTGAAAAAGTAAATCGTGAAAG
GAAGTATCATCAGCAAACCACTGCGTACGAGCTCAATGCTCTATCTCAAGAATGGAGGCAGCTCTGTGTGAAGAATATGG
AGATTCAATCTGCTTGTGTCGTGCTAGAGACAAAAATCGATGCGTTCAAAAAGGAAGCTGCTGAAAGAGGATGGAACTTA
GAAGAGAAACTAGAGAGTGTCAAGCCGCTTCAACCGCAGTGA