Details for Chinese cabbage Locus Brara.A02947

Position : A01 ( 5`- 25114789 .. 25116530 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02947

Protein [Map View]
MWKQELLDVILVPAGLAVMVAYHVWLGYAIIHRPKLTVISLNAESRRQWVFSMMTEPLKNGTLAVQTIRNNIMASTLLAT
TAITLCSIIGVFVSNTSASKSTASPIIFGNKSPLLATIKNFAILVCFLMAFLCNVQSIRYYAHVSFLITVPVSRGKREHC
EYVSRNLNRASYFWSLGLRAFYFSFPLFLWNFGPIPMFVCCCMMSSILYFLDTTTSFTRHLHSESFREIAESMDGEIESA
VHSL*

DNA
ATGTGGAAGCAGGAATTGTTGGATGTAATACTTGTGCCAGCGGGTCTCGCCGTGATGGTCGCCTACCACGTCTGGCTCGG
CTACGCTATAATCCACCGTCCCAAGCTCACTGTAATCTCCCTCAACGCTGAGTCTCGACGGCAATGGGTCTTCTCTATGA
TGACCGAGCCGCTGAAAAACGGTACACTGGCAGTACAGACAATAAGGAACAACATAATGGCATCAACACTTTTAGCCACA
ACAGCAATCACTCTCTGTTCCATCATCGGCGTCTTCGTAAGCAACACCTCTGCTTCCAAATCCACAGCCTCGCCTATCAT
ATTCGGAAACAAAAGCCCTCTCCTTGCAACCATCAAGAACTTCGCGATCCTCGTATGTTTCCTCATGGCCTTTCTCTGCA
ACGTCCAGTCCATCAGGTACTACGCTCATGTGAGTTTCCTGATCACGGTTCCTGTCTCTAGAGGGAAGAGAGAGCATTGT
GAGTACGTTTCTAGAAACCTGAACCGAGCTAGCTACTTCTGGTCTCTTGGACTGCGAGCTTTCTACTTCTCCTTCCCGCT
CTTCTTGTGGAACTTTGGTCCCATACCTATGTTTGTGTGTTGCTGTATGATGTCGTCGATTCTTTATTTCTTGGACACGA
CCACTAGCTTCACTAGGCATCTCCATAGCGAGTCGTTCAGAGAGATTGCTGAGTCTATGGACGGTGAAATCGAATCAGCC
GTTCATTCTCTGTAG