Details for Chinese cabbage Locus Brara.A02945

Position : A01 ( 5`- 25085642 .. 25095742 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02945

Protein [Map View]
MAKITLGSHTVKSYGWKMAREHLRDWSILVLLCLIDIVLNSIEPFHRYIGPDIDVYDLHHAILGIAFSCLVTGVTTDSIK
DAVDWPRPNFFYRCFPDGKPKFDPETRMLYHGVKKIIKEGYKSFPSGHTSWSFAGLTFLACYLSGKIKVFDRRGHVAKLC
LVFLPILVAVLIGISRVDDYWHHWTDVFAGTIIGTFVASFSYLHFFSLPIRRKCHDNDTRSGSRVMLDEDVEPGSTYFPH
DCNRESTILNFKYSLRIY*

DNA
ATGGCTAAGATAACACTTGGATCTCACACGGTGAAGAGCTACGGATGGAAAATGGCCCGAGAACATCTACGTGACTGGTC
CATCCTTGTCCTACTCTGTCTGATCGATATTGTTCTCAACAGTATCGAGCCTTTTCACCGTTACATCGGACCAGACATAG
ATGTTTATGATCTTCATCACGCCATTCTCGGTATCGCATTCTCATGTCTTGTGACTGGAGTCACCACGGACTCCATCAAA
GATGCAGTCGATTGGCCACGACCTAACTTCTTTTACCGATGTTTTCCCGACGGTAAACCGAAATTTGACCCGGAAACTAG
GATGTTGTACCATGGAGTTAAAAAGATAATCAAAGAAGGTTACAAGAGTTTCCCTAGTGGTCACACTTCATGGTCATTTG
CTGGTTTAACATTCTTGGCGTGTTACTTATCGGGTAAAATCAAAGTCTTTGACAGAAGGGGACATGTGGCGAAGCTATGC
CTTGTGTTCTTACCGATACTCGTCGCAGTTCTTATCGGAATATCACGTGTCGACGACTATTGGCACCATTGGACCGACGT
CTTCGCCGGAACGATCATCGGAACATTTGTCGCTTCTTTCTCTTATCTCCACTTTTTTTCCTTACCCATTCGACGAAAAT
GCCACGACAATGACACACGGAGCGGTTCTCGAGTGATGTTGGACGAAGACGTCGAGCCTGGTTCCACCTACTTTCCGCAC
GATTGTAATCGAGAAAGCACTATTCTGAATTTTAAATATTCCCTGCGCATTTATTAA