Details for Chinese cabbage Locus Brara.A02944

Position : A01 ( 5`- 25081048 .. 25083742 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02944

Protein [Map View]
METPLPPMSHLASNLTSTTVVSTTIDGSPRAVAIDTGGNMEPLAAVPDAKLRLMCSFGGHIMPRPHDKALTYSSGETRLV
VIDRRASLASLRSRLSSMLLNGRSFTLKYQLPSEDLDSLVTITTDEDLENMIEEYDRATSSATAAATQRIRLFLFANKLE
TAATMGSLLDSAKSETWFVNALNQSGLLPRGLSDSAAVNNNLVNLDEVGEGEAEVQKIGADEGCVNNKQGGYVTNGVISH
QEMHMSSMPDSPMMEPAGGSSIGSSSSSPSTANLPPIRVRVSEDQRMEQQFAQMSFTNVDGQRNMEDGAGLVANRPMMTD
SAMVHNNNTPIDGATVAAAAMSNGQVSPHDDRSDPGMMAGYRKPPLPMQPVAIPQRGAGGYGLTSPDSVASDTSISSATS
FSKPVYYQDQAPTMLRAPVTQPEITPVQTSHGIPQHEPTSAQTTSHVLSQPSTYTTLDQQHQPPVQQPFLHQGVQYIPHP
SQYIPVYPHQQQNYPVYVMSVPQSQQYVPAGTPPLYPNSAPATNPRPEVAQNVYRSPISQNPQVQQQQQQTQHHYMGYAG
GSQHNTNANPNYSTGAYEYTHPPNETMYYHAQRLPTNNAIPLASPYQSMTPAAAAAALADMSKQMSLASDKEQQQHMASS
QPL*

DNA
ATGGAGACGCCACTCCCACCTATGTCGCATCTAGCTTCAAATCTTACGTCAACCACAGTTGTCTCAACTACCATCGATGG
ATCCCCACGCGCCGTTGCCATTGATACCGGAGGAAACATGGAGCCCCTGGCGGCCGTTCCCGACGCAAAGCTACGCCTCA
TGTGCAGCTTCGGTGGCCACATCATGCCTCGTCCCCATGACAAGGCCCTAACGTACTCTAGTGGCGAGACGCGTCTTGTG
GTTATTGATCGACGCGCTTCACTGGCCTCGCTAAGATCTCGTCTCTCTAGTATGCTCCTCAACGGCCGGTCTTTCACGCT
CAAGTACCAGCTCCCTAGCGAAGATCTTGACTCACTCGTCACCATCACTACCGATGAAGATCTTGAGAACATGATTGAGG
AGTATGATCGTGCGACGTCGTCAGCTACGGCGGCTGCCACGCAACGGATCAGGCTGTTTCTTTTCGCGAACAAGCTTGAG
ACGGCTGCTACCATGGGGTCTCTTCTTGATAGTGCGAAGTCGGAGACATGGTTTGTTAATGCTTTGAACCAATCCGGTTT
GCTTCCTCGTGGCTTGTCGGACTCAGCCGCGGTGAACAACAACTTGGTGAATCTTGACGAGGTAGGTGAAGGTGAAGCTG
AAGTTCAAAAAATAGGAGCGGATGAGGGTTGCGTGAACAACAAGCAAGGAGGTTATGTGACAAACGGTGTGATCTCTCAT
CAGGAGATGCATATGAGTTCGATGCCTGACTCGCCTATGATGGAACCTGCCGGTGGTTCTTCGATAGGATCGTCCTCTTC
CTCTCCTTCCACAGCCAACTTGCCACCGATCCGCGTTAGAGTCAGTGAAGACCAGAGGATGGAACAACAGTTTGCTCAAA
TGAGCTTCACAAACGTGGACGGTCAGAGGAATATGGAAGATGGCGCTGGCTTGGTGGCAAATAGGCCAATGATGACCGAT
TCTGCGATGGTGCATAACAACAACACACCTATTGATGGTGCTACTGTTGCTGCTGCCGCTATGAGCAATGGCCAGGTTTC
ACCACATGACGATCGATCCGATCCAGGTATGATGGCTGGATATAGGAAGCCACCTTTGCCGATGCAGCCAGTGGCGATCC
CACAGCGAGGTGCGGGTGGGTATGGCTTGACATCTCCTGATTCTGTTGCAAGTGATACTAGCATATCTTCTGCTACTTCA
TTTTCGAAGCCGGTGTACTACCAAGACCAAGCTCCAACTATGCTAAGAGCCCCGGTAACACAGCCTGAAATTACTCCGGT
CCAAACTAGCCACGGCATACCTCAGCATGAACCCACTTCAGCCCAAACCACATCGCACGTCCTATCTCAGCCAAGTACAT
ACACAACTTTGGACCAACAACACCAACCTCCGGTTCAACAACCTTTCTTACACCAAGGTGTTCAATACATTCCTCATCCA
TCACAATACATCCCGGTTTACCCTCATCAGCAGCAAAACTACCCAGTTTACGTGATGTCTGTCCCGCAATCTCAGCAATA
TGTTCCAGCTGGAACTCCTCCGCTCTATCCAAACTCAGCACCTGCCACAAACCCAAGACCTGAAGTAGCTCAAAACGTTT
ACCGGTCCCCTATATCACAGAATCCTCAGGTTCAGCAGCAACAACAACAGACTCAACATCATTACATGGGTTACGCAGGA
GGTTCTCAACACAACACAAACGCAAATCCTAACTACAGTACTGGAGCGTACGAGTACACACATCCGCCAAACGAGACAAT
GTATTACCATGCACAACGTCTCCCCACCAACAATGCTATTCCGTTAGCTTCTCCGTATCAAAGCATGACACCAGCCGCAG
CCGCAGCTGCTTTAGCTGATATGTCTAAGCAGATGAGTCTTGCTAGTGACAAAGAGCAACAACAACATATGGCTTCGTCT
CAACCGCTCTAA