Details for Chinese cabbage Locus Brara.A02943

Position : A01 ( 5`- 25079586 .. 25080005 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02943

Protein [Map View]
MARHLEDVMSMATTTQFHVSYLVHVVFLALLGCCVLSAVLLSCADGASDDRATSGNTPAAGGCGGAGCGGGCGG*

DNA
ATGGCTAGACACTTAGAAGATGTAATGAGCATGGCGACAACAACACAGTTCCATGTTAGTTACCTTGTTCATGTTGTGTT
CTTGGCTCTATTAGGCTGCTGTGTCCTCTCGGCCGTATTACTCTCTTGCGCCGATGGAGCTTCCGACGACAGAGCCACTT
CTGGTAACACACCCGCTGCCGGAGGTTGTGGCGGAGCCGGTTGCGGCGGTGGTTGTGGAGGTTAA