Details for Chinese cabbage Locus Brara.A02940

Position : A01 ( 5`- 25057563 .. 25063594 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02940

Protein [Map View]
MATPLPDFEATRAASSSSTTVISSSVPSSSRPPAANSFSEDAEEISPILFFLFFHKAVCSELESLHRLALEFATGHHVDL
RLLRERYRFLRSIYKHHCNAEDEVIFSALDIRVKNVAQTYSLEHKGESTLFDHLFELLNPSTEIDESYRRELASSTGALQ
TSVSQHLAKEQKQVFPLLIEKFKHEEQAYIVWRFLCSIPVNMLAVFLPWLASSISVDESKEMQTCLSKIVPDEKLLQQVI
FTWLGRKSDTAASCRIEDSLFQCCIDSSSSMLPCETSRAQCACEGTKVGKRKYQELTSHDSFDTQMHPIDEIKLWHKAMN
KEMKEIADEARKIQLSGDFSDLSAFDELNHKCLEKSLETNCPICCEFLFTSSETVRALPCGHYMHSACFQAYTCSHYTCP
ICGKTLGDMGVYFGMLDALLAAEELPEEYKDRCQDILCNDCQRKGTTQFHWLYHKCGSCGSYNTRVIRSETAAPDCPTSS
*

DNA
ATGGCGACGCCTTTACCGGATTTTGAGGCGACGAGAGCAGCCTCTTCGTCATCAACCACGGTCATCTCGAGCTCCGTACC
TTCTTCCTCTCGTCCCCCTGCGGCGAATTCGTTCTCGGAGGACGCGGAAGAGATTTCTCCGATCCTGTTTTTCCTCTTCT
TCCACAAAGCCGTCTGCAGCGAGCTCGAATCGCTTCATAGGTTGGCGTTGGAGTTCGCCACGGGGCACCACGTCGATCTC
CGGCTGCTTCGTGAACGGTACCGGTTCTTGAGATCGATCTATAAGCATCACTGCAATGCCGAGGATGAGGTGATCTTTTC
AGCTCTTGACATACGCGTGAAGAACGTAGCGCAGACGTATTCTCTTGAACACAAGGGTGAGAGCACTCTTTTTGATCATC
TCTTTGAGCTGCTGAATCCTTCCACGGAGATTGATGAAAGTTATCGAAGGGAGTTGGCGAGCAGTACTGGAGCGCTTCAG
ACTTCTGTTAGCCAGCATTTAGCGAAAGAACAGAAGCAGGTGTTCCCGTTGCTTATTGAGAAGTTTAAGCATGAGGAGCA
AGCTTACATAGTCTGGCGGTTTCTCTGCAGCATTCCTGTGAATATGCTTGCCGTGTTTCTTCCATGGCTCGCCTCCTCCA
TTTCAGTTGATGAAAGCAAGGAGATGCAGACGTGCCTAAGCAAGATAGTTCCAGACGAGAAGCTTCTTCAGCAGGTTATT
TTCACCTGGTTGGGAAGGAAAAGCGATACTGCGGCTTCATGTCGCATAGAAGATTCTCTGTTCCAGTGCTGTATAGATTC
TTCTAGCAGCATGCTTCCTTGCGAAACTAGTAGAGCACAGTGCGCATGTGAGGGAACCAAGGTCGGGAAGAGAAAGTACC
AAGAGCTTACCAGTCATGATTCTTTTGATACCCAGATGCACCCAATTGATGAGATAAAGCTTTGGCACAAGGCAATGAAC
AAGGAGATGAAAGAAATAGCCGATGAGGCTAGGAAGATTCAGCTGTCTGGAGATTTTTCGGATTTATCTGCATTTGATGA
ACTAAACCACAAGTGCCTCGAGAAAAGCCTTGAGACAAATTGCCCCATTTGCTGCGAGTTTCTTTTCACATCAAGTGAAA
CAGTCAGAGCTTTACCATGTGGTCACTACATGCACTCAGCTTGCTTCCAGGCTTACACTTGCAGCCACTACACATGTCCA
ATCTGTGGAAAAACATTAGGAGATATGGGGGTTTACTTCGGTATGCTTGATGCATTGTTAGCTGCAGAAGAACTTCCAGA
AGAATACAAAGATCGCTGTCAGGACATTCTATGTAATGACTGTCAACGAAAAGGAACGACACAGTTCCATTGGTTGTATC
ATAAATGCGGAAGCTGCGGTTCTTACAACACCCGTGTGATCAGATCAGAAACAGCCGCCCCAGACTGCCCAACCTCATCT
TGA