Details for Chinese cabbage Locus Brara.A02939

Position : A01 ( 5`- 25052495 .. 25053527 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02939

Protein [Map View]
MEFPPPPERSKRLHNFTLPYLRWGHQRFLKCVKLPPSSSPDHRSPAGDGKLRLDPPKVSTLGNGGGGDAAAARPWNLRTR
RAACNEPGDEEPTRITGVVVKRGGSHEGDSSPQKKLKFSVSLLREEIEDDFTAFVGKKPPRRPKKRPRTVQKQMNTLFPG
LWLAEEVTACSYDVPEAAAET*

DNA
ATGGAGTTCCCTCCGCCCCCGGAGAGATCAAAGCGCCTCCACAACTTCACCTTACCTTATCTCCGATGGGGTCACCAGAG
ATTCCTCAAGTGCGTCAAGCTCCCCCCTTCTTCTTCTCCCGATCACAGATCTCCCGCTGGAGACGGGAAGCTAAGGCTCG
ATCCACCAAAGGTCTCGACTTTGGGGAACGGAGGAGGAGGCGATGCAGCAGCAGCTCGGCCGTGGAATCTGAGGACGAGG
AGAGCTGCTTGCAACGAGCCGGGAGATGAGGAGCCCACGAGGATCACTGGCGTCGTCGTCAAGAGAGGAGGTAGTCACGA
AGGAGATTCATCGCCGCAGAAGAAATTGAAATTCTCTGTTTCTTTGTTGAGAGAAGAGATCGAGGATGATTTCACTGCCT
TCGTTGGCAAAAAGCCTCCTCGTAGGCCCAAGAAGAGACCAAGAACTGTTCAGAAGCAAATGAATACTCTTTTTCCCGGA
TTGTGGTTAGCTGAAGAAGTAACAGCATGCTCTTACGACGTCCCTGAGGCTGCTGCTGAAACATGA