Details for Chinese cabbage Locus Brara.A02937

Position : A01 ( 5`- 25044558 .. 25045421 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02937

Protein [Map View]
MNSTFNDHHHLKREPNDNSGVGIIYPPSPSPLLKLNKDSHVIKKPPSPSSSSSTAAKPRQPVIIYTNTPKVIHTNPKDFM
ALVQKLTGMSHSEEDSGGSSSAVTDRGGKSINRSVSDLTVDRKVNRTRCGGGGGGGGGGGGGHNSYNRTYSGPGGANGKG
IFFSNTTICEDSESSSVITTDENMGGGGEHGHVNSSLPYSAVAVSPFPHPPPPPPPPPQSMYDGTNGINYSSYFSTLLPV
NPADNFLCGNQNFANFDDPLYFMPNMRSSFSSSSSSGFDGLTEFRDF*

DNA
ATGAACTCAACGTTCAACGACCACCATCACCTAAAGAGAGAGCCTAATGACAACTCCGGCGTCGGAATCATATATCCTCC
GTCACCTTCTCCGCTGCTAAAACTAAACAAAGACTCCCACGTCATCAAAAAGCCACCCTCGCCGTCGTCTTCCTCCTCTA
CCGCCGCGAAGCCTCGCCAGCCGGTGATCATCTACACGAACACGCCCAAAGTTATACACACCAATCCTAAAGATTTCATG
GCTCTCGTCCAAAAACTCACCGGAATGTCTCACTCCGAGGAAGATTCCGGCGGTAGCAGCAGCGCGGTAACGGATCGTGG
AGGAAAATCAATCAACCGGAGTGTCTCTGATCTCACCGTTGATAGAAAAGTTAACCGGACTCGCTGCGGTGGAGGCGGCG
GTGGTGGTGGCGGTGGTGGTGGTGGACATAACAGCTACAACAGAACCTATTCAGGTCCGGGAGGAGCTAACGGGAAAGGG
ATTTTCTTCAGCAATACTACTATCTGCGAAGATAGTGAATCGTCCTCTGTGATCACAACCGATGAGAACATGGGAGGAGG
AGGAGAGCATGGACATGTTAACTCGTCGCTACCGTATTCAGCGGTGGCTGTTTCTCCATTTCCTCATCCTCCGCCACCAC
CTCCACCGCCTCCTCAGTCCATGTACGATGGGACCAATGGGATTAACTACAGCTCTTACTTCTCGACGCTTTTGCCGGTG
AATCCAGCTGATAATTTTCTTTGCGGGAATCAAAACTTTGCTAACTTTGATGATCCGCTTTACTTCATGCCTAATATGAG
GAGCTCTTTCTCTTCTTCTTCCTCTTCTGGGTTTGATGGCTTAACTGAGTTTAGAGATTTTTGA