Details for Chinese cabbage Locus Brara.A02936

Position : A01 ( 5`- 25041156 .. 25043568 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02936

Protein [Map View]
MGRPPSNGSPAFRFNLAEVTEMEAVLKQHNTAMPGRDTLEALADKFSDTVERKGKTVVQFKQIWNWFQNRRYALRASRNK
VPGKLNVSSMPRSVDPTNPMRNVLPPSTGPKPPHMIGNLSGMTPAPPAPGVMRSGSDNSYLEFEAKSARDGAWYDVQAFL
AHRNLEIGDPEVQVRFAGFEVEEDEWINVKRHVRQRSLPCEASECVAVLAGDLVLCFQEGKDQALYFDATVLDAQRRRHD
VRGCRCRFLVRYSHDQSEQEIVPLRKICRRPETDYRLQQLHSAANDFANSKPAPDAAAKTPLPPSTASVPIVPPDVKDPS
LSAASATSAQPSSNAATVPAGSA*

DNA
ATGGGTCGACCTCCGAGTAATGGCAGTCCAGCGTTCCGATTCAACCTCGCCGAGGTAACGGAGATGGAAGCAGTATTGAA
ACAGCATAACACAGCAATGCCAGGTCGAGATACACTTGAAGCTCTTGCTGATAAGTTTAGTGACACTGTGGAGCGCAAGG
GGAAAACTGTTGTGCAATTCAAACAAATATGGAACTGGTTCCAGAACAGGCGATATGCTTTAAGGGCAAGTAGAAACAAA
GTTCCTGGGAAGCTGAATGTATCTTCCATGCCGCGCAGTGTGGATCCAACAAACCCAATGAGGAACGTGCTTCCACCATC
AACCGGTCCTAAACCCCCTCATATGATTGGGAATCTATCCGGGATGACACCTGCCCCTCCCGCTCCAGGTGTCATGAGGA
GTGGTTCAGACAATTCTTACTTGGAATTTGAAGCCAAATCTGCCAGAGATGGTGCATGGTATGATGTACAAGCTTTCCTA
GCTCATAGAAACTTGGAGATTGGTGATCCGGAAGTGCAGGTTCGATTTGCGGGTTTTGAAGTTGAAGAAGATGAGTGGAT
AAACGTCAAGAGGCACGTAAGGCAACGGTCACTCCCATGTGAAGCATCAGAATGTGTTGCAGTTCTTGCTGGAGATCTCG
TGCTTTGCTTCCAGGAAGGGAAAGATCAAGCCCTTTACTTTGACGCCACTGTTCTCGATGCACAAAGAAGGAGACACGAT
GTCAGAGGTTGTCGCTGCAGGTTCTTGGTGCGCTACAGCCACGACCAGTCCGAGCAGGAGATCGTCCCATTGAGGAAGAT
TTGCAGGCGGCCCGAGACTGATTACAGGCTACAGCAACTCCACAGTGCTGCCAATGACTTTGCTAACTCCAAACCCGCTC
CAGATGCGGCTGCAAAAACTCCTCTTCCACCATCCACCGCCTCAGTCCCCATTGTTCCACCTGATGTGAAAGATCCGAGC
TTGAGCGCCGCTTCAGCTACTTCAGCTCAGCCTAGCTCCAATGCAGCCACTGTCCCCGCTGGTTCTGCATAG