Details for Chinese cabbage Locus Brara.A02934

Position : A01 ( 5`- 25034004 .. 25036025 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02934

Protein [Map View]
MEENLPPGFRFHPTDEELITHYLCRKVSDIGFTAKAVVDVDLNKCEPWDLPDKASMGEKEWYFFSLRDRKYPTGLRTNRA
TEAGYWKTTGKDKDIYRSGVLVGMKKTLVFYKGRAPKGEKSNWVMHEYRLENKQPFKPAKEEWVVCRVFQKSTTTKKPQE
QQPDSSFGSPCDANSSMANEFEDIELPNLNSNSSTVDYNNIHQQYSQNNVYSDNTTSTAGLNMNMNVNMANLPAWTTSLL
GPPLSPINSLLLKAFQIR

DNA
ATGGAAGAAAATCTTCCTCCAGGGTTCAGATTTCATCCTACAGACGAAGAGCTTATAACACATTATCTTTGTCGGAAAGT
CTCCGATATTGGATTCACTGCTAAAGCTGTCGTCGACGTTGATCTCAACAAGTGTGAACCTTGGGATCTGCCAGACAAAG
CTTCAATGGGAGAGAAAGAGTGGTACTTCTTCAGTCTACGAGACCGGAAATATCCAACCGGTTTAAGGACAAACCGAGCA
ACTGAAGCCGGTTATTGGAAAACCACTGGTAAAGATAAAGATATATACCGAAGTGGAGTACTGGTAGGGATGAAGAAAAC
CCTAGTTTTCTACAAAGGAAGAGCTCCAAAGGGTGAGAAAAGCAATTGGGTTATGCATGAGTATAGGCTTGAGAACAAAC
AACCCTTCAAACCCGCTAAGGAGGAATGGGTAGTGTGTAGGGTTTTCCAAAAGAGCACAACAACAAAGAAACCACAGGAA
CAACAACCAGACTCATCTTTTGGATCTCCATGCGATGCAAACTCATCCATGGCAAACGAGTTTGAAGATATCGAGCTTCC
AAATCTGAACTCAAACTCATCAACCGTTGATTACAATAATATTCATCAACAATATTCTCAAAACAACGTTTATTCCGACA
ATACTACAAGTACGGCTGGTCTCAACATGAACATGAACGTGAACATGGCTAATCTTCCGGCTTGGACAACAAGTCTACTT
GGTCCGCCTTTATCTCCAATCAACTCTTTGTTGCTCAAGGCTTTCCAAATTAGG