Details for Chinese cabbage Locus Brara.A02929

Position : A01 ( 5`- 24986723 .. 24989021 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02929

Protein [Map View]
MAFTPLFSLLSVITLSLLITTDASSRSLLPSHETTVLDVVSSLQQTQHILSLDPTLTSLTTTTSIPGSDPVFLNSSSPLS
LELHSRDTLVASQHKDYKSLVLSRLERDSSRVAGITAKIRFAVEGIDRSDLKPVYNDKTLYQPEDLTTPVVSGASQGSGE
YFSRIGVGTPAKEMFMVLDTGSDINWIQCQPCSDCYQQSDPVFDPASSSTFKSLSCSAPQCGSLEVSACRSDKCLYQVSY
GDGSFTVGDYATDTVTFGTNGKVNDVALGCGHDNEGLFTGAAGLLGLGGGALSMTNQIKATSFSYCLVDRDSGKSSSLDF
NSVQAGTGDATAPLLRNSKIDTFYYVGLSGFSVGGQQVSIPSSVFAVDASGAGGVILDCGTAVTRLQTQAYNSLRDAFVK
LTANLKKGTSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKSIDLPAKNYLIPVDDAGTFCFAFAPTSSSLSIIGNVQQQG
TRITYDLANNLIGLSANQC*

DNA
ATGGCTTTCACTCCATTGTTCTCTCTCCTCTCCGTCATCACTCTCTCTCTCCTCATCACCACCGATGCTTCCTCTCGTTC
TCTACTACCTTCACACGAAACCACCGTCCTCGACGTTGTCTCATCTCTCCAGCAAACCCAACACATCCTCTCGCTCGACC
CGACCCTTACCTCACTCACCACCACCACCTCCATACCCGGATCCGACCCGGTTTTCCTCAACTCATCTTCCCCACTATCT
CTCGAGCTTCACTCCCGCGACACTCTCGTCGCATCGCAGCACAAGGACTACAAAAGCCTAGTACTGAGCCGACTCGAGCG
AGACTCATCCCGAGTCGCCGGAATCACCGCCAAGATCCGATTCGCCGTCGAGGGCATCGACAGATCCGATCTCAAACCCG
TTTACAACGACAAGACCTTATACCAACCCGAGGATCTAACAACACCCGTCGTCTCCGGAGCTAGCCAAGGAAGCGGCGAG
TATTTCTCCCGCATCGGAGTCGGAACTCCGGCGAAGGAGATGTTCATGGTGCTCGACACCGGAAGCGACATAAACTGGAT
CCAGTGCCAGCCTTGCTCCGACTGCTACCAACAATCCGACCCGGTTTTCGACCCGGCTTCGTCCTCCACGTTCAAGTCTC
TCTCCTGCTCGGCCCCACAGTGCGGTTCTCTAGAAGTCTCCGCTTGTCGCTCGGACAAGTGTCTCTACCAAGTTAGTTAC
GGAGACGGATCTTTCACCGTTGGAGATTACGCTACCGATACGGTGACGTTTGGAACCAACGGTAAAGTAAACGACGTCGC
TTTGGGGTGTGGGCACGATAACGAAGGTCTTTTCACAGGAGCAGCCGGTTTACTCGGTTTAGGAGGTGGAGCTTTGTCTA
TGACCAATCAGATCAAAGCGACGTCGTTCTCCTACTGCCTCGTTGATCGTGACTCGGGGAAGTCCTCGAGTCTCGACTTC
AACTCGGTCCAAGCCGGAACCGGAGACGCGACGGCTCCGCTCCTCCGCAACAGCAAGATCGACACTTTCTACTACGTCGG
ACTCAGCGGGTTTAGCGTCGGCGGTCAGCAAGTCTCCATCCCTTCGTCGGTGTTCGCCGTCGACGCTTCGGGAGCCGGAG
GAGTGATCTTGGACTGCGGAACCGCCGTGACTCGTCTCCAGACTCAGGCCTACAACTCGCTGCGCGACGCGTTCGTTAAA
CTCACCGCGAATCTCAAGAAGGGGACGTCGAGCATCTCGCTCTTCGACACTTGCTACGACTTCTCGTCTCTCTCCACCGT
GAAAGTCCCGACGGTGGCGTTTCATTTCACCGGTGGTAAGTCGATTGATTTGCCGGCGAAGAATTACTTGATCCCTGTGG
ACGATGCCGGAACGTTCTGCTTTGCTTTTGCTCCGACGTCGTCGTCGTTGTCGATCATCGGGAACGTGCAGCAGCAAGGG
ACACGTATCACTTACGATCTGGCGAATAATCTAATCGGATTGTCAGCGAATCAATGCTAA