Details for Chinese cabbage Locus Brara.A02928

Position : A01 ( 5`- 24972295 .. 24972450 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02928

Protein [Map View]
MREKSKEEAVKKWEKKKECSSPKGVGKVRNKKKGKFYIIGKCITMLLCSHE*

DNA
ATGAGGGAGAAGTCGAAGGAGGAGGCAGTGAAGAAATGGGAGAAGAAGAAGGAGTGTTCTTCACCAAAAGGAGTTGGGAA
GGTTCGGAACAAGAAGAAAGGAAAGTTCTACATTATTGGAAAATGTATTACTATGCTTCTTTGTTCACACGAGTGA