Details for Chinese cabbage Locus Brara.A02927

Position : A01 ( 5`- 24968034 .. 24970355 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02927

Protein [Map View]
MVVETPENSYEVKTWLRHLDEFSNGYINNAAGVSSSEDHLQPGQQLLIVDWVGTNGDEGYCVNVPWSCGGVGDNVYIYAF
QQVVIPIASAFSPDFIIVLVGFDAARGDPLECCDYCLVHFIGGYSVQFWFKEIKFSLYLQVTSAGYSRTTQMLVLMDDNP
ENELPIATTPSRAGLQTVIDIMNIQMKFCPLLATAYSKLLSEWETHLIKNKKNQVKRKLVQVPTWWKWSRKKLCTTFSLL
VWIQDQIDDINTSS*

DNA
ATGGTTGTAGAAACCCCCGAGAACTCTTATGAAGTGAAAACATGGCTACGGCACCTCGATGAGTTCAGCAATGGATACAT
AAACAATGCAGCTGGTGTTTCATCATCCGAAGATCATCTGCAGCCAGGTCAACAGCTGTTGATTGTGGACTGGGTTGGGA
CAAATGGTGATGAGGGTTATTGTGTAAATGTTCCATGGAGTTGTGGTGGAGTTGGTGATAATGTATATATATATGCCTTT
CAGCAGGTTGTTATTCCCATAGCTTCTGCGTTCTCTCCTGATTTTATCATCGTATTAGTGGGATTTGATGCAGCTAGAGG
AGACCCACTAGAATGCTGTGATTATTGTCTTGTGCACTTCATCGGAGGATATTCTGTTCAATTTTGGTTTAAAGAAATCA
AGTTTAGTCTTTACTTACAAGTAACTTCAGCTGGTTATTCTCGAACGACACAGATGCTAGTGCTTATGGATGATAATCCG
GAGAACGAGTTGCCTATAGCGACTACGCCTTCAAGAGCTGGCCTGCAAACTGTTATTGATATAATGAATATCCAAATGAA
GTTCTGTCCATTACTTGCTACCGCCTATTCTAAATTACTCTCAGAGTGGGAAACACATCTGATTAAAAACAAAAAAAATC
AGGTGAAAAGGAAGCTTGTTCAGGTCCCTACATGGTGGAAATGGAGTCGAAAGAAGCTTTGTACAACGTTCTCTCTGCTC
GTATGGATTCAAGATCAAATAGATGATATAAACACATCTTCCTAA