Details for Chinese cabbage Locus Brara.A02926

Position : A01 ( 5`- 24948843 .. 24951203 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02926

Protein [Map View]
MNNNKTFSTTSTINEDYMSFPYNDNYCSQPLLPFSPSSSINDLLIHSNSNTSNNHLDHHHQFLQAASPFSQFEFVQDFSL
LPSFLPQNIAHNDNQTISINDHHHPSLLPLNNTIDESQLIEPSETITTHNEDSQRISTTQDPKMKNAKKPSRTDRHSKIK
TAKGTRDRRMRLSLDVAKELFGLQDMLGFDKASKTVEWLLTQAKPEIIKIANSLSNQFKHGGFSSGDDSQTRPALGSTET
SSDLCEFASVWTVEDRGSNTSMTENKVDGRTMRGKRKMSQRTPILKEMSKDARAKARERAKDRTMEKIMKRRRPQVNAVE
EVEAHNQHDEVVKNNNSGVNWTTSFEVTPCGENMEELCKNNRFAVYNDFVVNKKDHISEESYNMISQLNSSFPMLTPHRS
QGAATSIEQQQQQQVRDVHHFLYNYHNM*

DNA
ATGAACAACAACAAGACTTTCAGTACTACAAGCACCATCAATGAAGACTACATGTCATTCCCTTATAATGACAATTATTG
CTCACAACCATTACTCCCTTTTAGCCCTTCCTCTTCCATTAACGACCTCTTGATTCACTCCAATTCCAACACATCAAACA
ATCATCTTGACCATCATCATCAATTCCTACAAGCAGCTTCTCCTTTTTCTCAATTCGAATTCGTCCAGGATTTTTCTCTC
CTCCCCTCTTTCCTCCCACAAAACATTGCCCATAATGATAACCAAACCATAAGCATCAATGACCATCATCATCCATCCCT
TCTTCCTTTGAACAACACCATTGATGAATCCCAACTCATTGAGCCGTCGGAGACCATAACCACACACAACGAAGACTCCC
AGAGAATCTCAACTACTCAAGACCCGAAAATGAAAAATGCCAAGAAACCAAGCAGAACGGACCGGCACAGCAAGATCAAA
ACGGCTAAGGGGACAAGAGATCGTAGAATGAGACTCTCTCTAGATGTCGCCAAAGAATTGTTTGGCTTACAAGACATGCT
TGGATTCGACAAAGCCAGCAAGACCGTTGAATGGTTGCTCACACAAGCCAAACCCGAGATCATAAAGATCGCCAACAGCC
TTTCTAACCAGTTTAAACACGGCGGATTCAGCAGCGGAGATGACTCCCAAACCCGACCGGCGTTAGGATCAACGGAGACA
TCGTCTGATCTATGCGAATTTGCATCTGTGTGGACAGTCGAGGATAGAGGCAGCAATACTAGCATGACCGAAAATAAGGT
GGATGGGAGAACAATGAGAGGGAAGAGAAAGATGTCGCAGCGAACGCCCATTTTGAAGGAGATGTCTAAAGATGCCAGAG
CCAAAGCAAGAGAGAGAGCAAAGGATAGAACAATGGAGAAGATCATGAAGAGAAGACGACCACAAGTAAATGCCGTAGAA
GAAGTAGAAGCTCATAATCAGCATGATGAGGTAGTAAAGAATAATAATTCTGGTGTTAATTGGACTACTTCTTTTGAGGT
GACGCCCTGCGGAGAAAATATGGAAGAACTTTGCAAGAACAATCGTTTCGCAGTTTACAACGATTTTGTGGTGAATAAAA
AAGATCACATTTCCGAAGAATCATATAATATGATCAGCCAATTGAATTCATCATTTCCAATGCTTACTCCCCATCGCAGC
CAAGGTGCAGCTACTTCCATAGAGCAGCAGCAGCAGCAACAGGTTAGGGATGTTCATCACTTCTTGTACAACTATCATAA
TATGTAA