Details for Chinese cabbage Locus Brara.A02925

Position : A01 ( 5`- 24933333 .. 24933917 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02925

Protein [Map View]
MEISRTEHVSSTHKRLNVSFIVSLMVLCARHASRVSKKLKLKPTRKATHLEDHLESPNSGGNHGGGGRFGWSPARAFSPM
RGRPKELLTTLSNKAKTMVGRKNKAYDVGGTPAKKKTAVEMVLEEEEEEFGIWQREILMGGKCEPLDHSGVIYYDCSGHQ
LKELPPRSPRASLVPDRPPRSYVGSVLNPTGKEM*

DNA
ATGGAGATTTCGAGAACGGAACATGTTTCCTCGACGCACAAGCGTCTAAACGTGAGTTTCATCGTCTCTCTTATGGTACT
TTGTGCTAGACACGCAAGCCGAGTCTCCAAGAAGCTTAAACTCAAGCCAACTCGTAAGGCAACTCATCTCGAAGACCATC
TCGAGAGCCCCAACTCCGGTGGAAACCACGGAGGAGGAGGAAGGTTTGGATGGAGTCCGGCGAGGGCTTTTTCGCCGATG
AGAGGACGTCCGAAGGAGCTTTTGACGACTTTGAGCAACAAGGCTAAGACTATGGTTGGCCGGAAGAATAAAGCTTACGA
CGTTGGAGGTACACCGGCGAAGAAAAAGACGGCGGTGGAGATGGTGTTGGAGGAGGAAGAGGAGGAGTTTGGTATTTGGC
AGAGAGAGATTTTGATGGGAGGAAAATGTGAGCCGTTGGATCATTCCGGCGTGATCTACTACGATTGCAGTGGACATCAG
CTAAAGGAACTGCCTCCGAGGTCGCCACGTGCCAGTTTGGTGCCGGATCGTCCGCCCCGTTCGTATGTCGGGTCTGTGTT
GAACCCGACGGGAAAGGAAATGTAA