Details for Chinese cabbage Locus Brara.A02924

Position : A01 ( 5`- 24925170 .. 24925664 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02924

Protein [Map View]
MAETLSTGESRYWPIYGSNTTERNSPYPSLLRLLRSHSPTSSHLFGFLALLISGCLLTFLLGVSLTATALGFIAFLPLII
ISGPIWLPGFVLVGRCLTVVRFLVGTVAIVSWTYRYFRGMHPAGSDQMDYARGRIYDTASHVKDYARKYGGYFHGRAKDA
APGA*

DNA
ATGGCCGAAACGCTTTCTACCGGCGAGTCTCGATATTGGCCCATCTACGGTAGCAACACCACCGAAAGAAACAGCCCTTA
CCCCTCGCTTCTCCGCCTTCTCCGATCTCATTCACCAACCTCCTCACATCTCTTTGGTTTCCTCGCTCTCCTCATATCCG
GATGCCTCCTCACCTTCCTCCTAGGTGTATCCCTGACCGCCACCGCGTTAGGCTTCATTGCGTTTCTTCCCTTGATCATC
ATCTCGGGTCCGATCTGGCTTCCGGGTTTTGTCCTTGTTGGCAGGTGCTTAACAGTCGTGAGATTTCTTGTTGGAACGGT
GGCTATTGTATCGTGGACGTACCGTTATTTTCGGGGAATGCACCCGGCTGGATCGGATCAAATGGACTATGCACGTGGTC
GGATCTATGACACAGCCTCGCATGTCAAAGATTACGCTAGAAAGTACGGTGGATACTTCCACGGTAGGGCTAAAGATGCA
GCCCCTGGTGCTTAA