Details for Chinese cabbage Locus Brara.A02922

Position : A01 ( 5`- 24915386 .. 24916028 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02922

Protein [Map View]
MSPSKKIITLVTILVSFFLFSCGVSSTELEFGGEDGWVVPNSNKTHGDMFNQWASHNRFKVGDTIRFKYKKDSVLVVSED
EYKECKATKPQLYSNNQDTVFKLDRPGLFYFISGVSGHCEKGQKMIIKVMETESSPDSPPPSSSSFSSLPASTHKKSSAL
KTAVQFTSSGFVVLIVSVLVWH*

DNA
ATGAGTCCATCTAAGAAGATCATCACTCTTGTTACTATTCTTGTTTCTTTTTTTCTGTTTTCATGTGGGGTTTCAAGCAC
TGAACTTGAATTTGGAGGAGAAGATGGTTGGGTCGTACCTAATTCTAACAAGACTCACGGAGATATGTTTAACCAATGGG
CTTCACACAACCGGTTTAAAGTTGGCGACACTATCCGTTTCAAATACAAGAAAGACTCAGTATTGGTGGTGTCAGAAGAC
GAGTACAAGGAATGCAAGGCAACTAAACCGCAACTCTATTCCAACAACCAAGACACGGTTTTCAAACTAGACCGTCCTGG
TTTGTTTTACTTCATCAGTGGTGTCTCGGGTCACTGTGAAAAGGGTCAGAAGATGATCATTAAAGTCATGGAGACCGAGT
CTTCGCCAGATTCTCCTCCTCCTTCATCCTCTTCTTTTTCATCTCTTCCGGCTTCAACTCACAAGAAGAGCAGCGCATTG
AAAACTGCTGTCCAGTTCACTAGTTCCGGCTTTGTGGTTCTTATTGTTTCGGTTTTGGTTTGGCATTAG