Details for Chinese cabbage Locus Brara.A02919

Position : A01 ( 5`- 24902005 .. 24905130 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02919

Protein [Map View]
MSGSGRKHVSKWDFKEDTHHHHPSVDVTSGSHYRDKDPQPVLFNAGSNANASRRSVDDQHSGQARTRGRVSQNNDNSYYS
EQDETRQQFSHRSDSRSYSRSRSRSRSPVFRPRRDHAGSYDRHKETRTRDEFNKPGSDYGWEDKASRKPRETRYHANDFR
GARSSDYDDTEERSRREHLHDGVSDPRLRRQGSELTGEKETQPRGGDGEGRFRRSSEIPCKFFAAGNCRNGHHCRFSHHR
GVDRKQPQENQNSFYRQDSNYHSGHNRWNGDERLDNGKLSKGTCETKGSSWIGDMEMSPDWNYSAHNLKKRMKEEPGVGQ
SSKSRVDDQRSSGMYSYGGNKPMLEKPIVADSHQNYNNVVNTAPPVQAYNQNHHDVLPYQNSPTPGGTQHQVIAPAAAAA
AAATDFSVGLNFRNPESVKAYNDNHHSMVEKAVPAQSSVTREQKDQLSNISATIAQLLANAQPIPQLTQALQMHLHSESS
MAVQPNHATTQSNNPFGMSTDTATASQATNVDGVQELPVNPKASEENGDTKTTDEASKQEEFKKAGEDVKEADNIVDEDD
DDGSDEEEEEDKKEMKDPKGMRTFKFALVEIVKELLKPAWKEGKMKKDGYKNIVKKVVEKVTGSMQSGNVPQTQEKIDHY
LSASKPKLTKLVQAYISKAKKT*

DNA
ATGAGTGGTTCGGGGAGGAAACATGTTTCTAAATGGGACTTCAAGGAAGACACACATCATCATCATCCTAGCGTAGATGT
AACATCAGGTTCTCATTACCGTGACAAGGATCCACAGCCTGTCCTGTTCAACGCAGGCAGTAATGCAAATGCAAGTAGAA
GGTCTGTGGATGATCAACACTCCGGTCAAGCTAGGACTAGAGGCAGAGTTTCACAGAATAACGATAACAGTTATTATTCT
GAACAAGATGAGACTAGGCAGCAATTTTCACATAGGAGTGATAGTAGAAGTTATAGCAGAAGTAGAAGCCGTAGCAGAAG
CCCTGTCTTTAGACCAAGGCGAGATCATGCAGGATCTTATGACAGACACAAGGAGACCAGAACACGAGATGAGTTCAACA
AGCCAGGCAGTGATTATGGTTGGGAAGATAAAGCTAGTAGAAAGCCAAGGGAGACAAGATATCACGCAAATGATTTCAGA
GGTGCAAGGTCTTCAGACTATGATGATACTGAGGAACGTTCTAGAAGGGAGCATTTACATGACGGCGTTTCAGACCCGAG
GTTGAGAAGACAAGGAAGCGAGCTGACAGGAGAGAAAGAAACGCAACCAAGAGGTGGTGATGGTGAGGGACGGTTCCGCA
GGAGCTCGGAGATACCCTGCAAGTTTTTCGCAGCAGGGAACTGTCGTAATGGCCATCATTGCAGGTTCTCTCATCATCGT
GGTGTTGATAGAAAGCAGCCTCAAGAGAACCAGAACAGCTTTTATAGACAGGACAGCAACTATCACAGTGGTCATAATAG
ATGGAACGGTGATGAAAGATTGGATAATGGAAAGCTCAGTAAAGGGACTTGTGAAACTAAGGGTAGTAGCTGGATTGGTG
ACATGGAGATGTCTCCAGATTGGAACTATAGTGCTCATAACTTGAAAAAACGTATGAAAGAAGAGCCTGGTGTTGGTCAG
AGTTCAAAGTCTCGAGTTGATGATCAGAGGAGCAGTGGTATGTATTCATATGGTGGCAACAAACCCATGCTTGAGAAACC
TATAGTAGCTGATTCTCATCAGAACTACAACAATGTGGTGAATACTGCTCCTCCAGTTCAAGCTTATAATCAAAATCATC
ATGATGTATTGCCGTACCAAAACTCGCCAACCCCTGGAGGAACTCAACACCAAGTGATAGCTCCTGCTGCTGCTGCTGCT
GCTGCTGCTACAGATTTCTCAGTAGGCTTGAACTTTAGAAACCCCGAGAGCGTAAAAGCTTATAATGATAATCATCATTC
AATGGTGGAGAAAGCTGTTCCGGCTCAAAGTAGTGTGACCAGGGAACAAAAAGATCAGCTTAGCAACATCTCAGCAACTA
TAGCGCAGCTTCTTGCAAATGCACAGCCCATTCCACAGCTTACACAAGCACTGCAGATGCACTTGCATTCAGAATCTTCC
ATGGCTGTTCAACCAAATCATGCTACTACTCAGAGTAACAACCCATTTGGGATGAGCACTGACACTGCGACTGCATCACA
GGCAACCAATGTCGATGGGGTTCAGGAACTGCCGGTAAACCCCAAGGCTTCTGAGGAAAACGGAGACACAAAGACCACTG
ACGAAGCTAGTAAACAAGAAGAGTTTAAGAAAGCTGGAGAAGATGTCAAAGAAGCTGATAACATTGTAGATGAAGATGAT
GATGATGGGAGCGATGAAGAAGAAGAAGAAGACAAGAAAGAGATGAAAGACCCGAAAGGAATGAGGACGTTCAAGTTTGC
GCTTGTTGAGATTGTGAAGGAGCTTCTGAAACCAGCTTGGAAAGAAGGTAAGATGAAGAAAGATGGTTACAAGAACATAG
TGAAGAAAGTAGTTGAGAAAGTGACTGGCTCTATGCAAAGCGGAAACGTTCCTCAAACACAGGAGAAGATTGACCATTAT
CTATCCGCTTCCAAACCGAAGCTTACAAAGCTCGTTCAGGCATATATCAGTAAAGCCAAGAAGACGTAA