Details for Chinese cabbage Locus Brara.A02918

Position : A01 ( 5`- 24900225 .. 24901241 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02918

Protein [Map View]
MSSSLSKTTKVSQFRPTLFQKASSLKAASLAKRQVTVFKKAEELSILCGVEVSVICYGSDGALRTWPKDREKVKDMAQRY
CQLSEVKRRIKQWDLDKFLEEVNKDPKKKKKVKLESSYKYPDWDPRFDNCSVEQLTELIQSLERKQTIMQDRLRAVLESQ
RQRNMYYMNMSNQEPTQMNHLQQQLPNQDQSLAPLPNSLTVYQYPNMDMYSSFLGGQETGRNEFLSTNMIPFNSNCVNMF
PNQFNQNCSKVEDYSGFPQGTGINNMNVEDYSGSLRAQGPNGLQNMDLQGYNNNRTNTNGFSHQLVQFPAQRAAPACQYV
DGSTQNIRPQFQYSSFVG*

DNA
ATGTCTTCATCTTTGTCGAAAACCACTAAAGTTTCCCAATTTCGACCAACCCTTTTTCAGAAAGCTTCTTCTTTGAAAGC
CGCAAGCTTAGCTAAAAGACAAGTGACTGTCTTCAAGAAAGCTGAGGAGCTTTCAATTCTCTGCGGGGTCGAAGTCAGCG
TCATCTGCTACGGATCAGACGGTGCGCTTAGAACATGGCCCAAGGACAGAGAGAAGGTCAAAGACATGGCTCAAAGGTAC
TGCCAGTTAAGCGAGGTGAAGCGACGCATAAAACAATGGGATCTTGACAAGTTTCTCGAGGAGGTCAACAAGGATCCCAA
AAAGAAGAAGAAAGTGAAACTTGAATCCAGTTACAAGTATCCGGATTGGGATCCCAGGTTTGATAATTGCTCTGTTGAGC
AACTCACGGAGCTGATTCAATCCTTGGAACGCAAGCAAACCATAATGCAAGATAGGCTTCGAGCAGTTCTTGAATCTCAG
AGACAGAGGAATATGTATTACATGAACATGTCTAATCAGGAACCGACGCAGATGAATCATCTTCAACAGCAGCTCCCTAA
CCAAGATCAATCCCTGGCTCCACTTCCAAATTCACTGACGGTGTACCAGTATCCAAACATGGATATGTACTCGAGTTTTC
TTGGGGGACAAGAAACTGGAAGGAATGAGTTTCTAAGCACGAACATGATACCCTTCAACAGCAACTGTGTTAATATGTTT
CCAAACCAGTTCAATCAGAACTGTTCCAAGGTCGAAGATTACTCTGGCTTTCCTCAAGGAACTGGGATCAACAACATGAA
CGTGGAAGATTATTCCGGGTCACTTCGGGCGCAAGGACCTAACGGGTTGCAGAACATGGACTTGCAAGGCTACAACAACA
ACAGGACTAACACCAATGGTTTCTCACATCAGCTTGTTCAGTTTCCGGCGCAAAGAGCAGCACCGGCCTGTCAATATGTG
GATGGGTCAACACAGAATATCAGACCTCAGTTCCAGTATTCTTCATTTGTTGGTTGA