Details for Chinese cabbage Locus Brara.A02917

Position : A01 ( 5`- 24893108 .. 24896539 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02917

Protein [Map View]
MANPPAATAATAATGGDSRRRLSASIEAICKRRFRRNSKGGGRPDMVKPFNIINFPTGDKNSNCCCSKFQIVKILLFILL
LATLFTIIYSPEVYHHSLSHSSSRWIWRRQDSRYVSDSDINWDDVTKTLESVQEGRTIGVLNFDSKEIQRWRDLAKTKDN
EDEENVVVLDLDYADKNVTWDSLYPEWIDEEQETEVPVCPDLPKIKVPTRRLDLIVVKLPCRKEGNWSRDVGRLHLQMAA
ATVAAAAKGFFRGHVLFVSRCFPIPNLFRCKDLVSRRGDVWLYKPNLDTLRDKLQLPVGSCELSLPLGIKERPSLGNPKR
EAYATILHSAHVYVCGAIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEAAGWQIRTIQRIRNPKAEKDAYNEWNYSKF
RLWQLTDYDKIIFIDADLLILRNIDLLFSMPEISATGNNGTLFNSGVMVIEPCNCTFELLMEHINEIESYNGGDQGYLNE
VFTWWHRIPKHMNFLKHFWVGDEDDVRRKKTELFGAEPPILYVLHYLGMKPWLCYRDYDCNFNSDIFVEFATDIAHRRWW
MVHDAMPKELHQFCYLRSKQKAQLEYDRRQAEAANYTDGHWKIRVKDPRFKICIDKLCNWKSMLRHWGESNSNWTDDESF
VPTPPAITAVRRSSLPGHNL*

DNA
ATGGCAAATCCCCCAGCCGCTACTGCAGCCACGGCCGCAACCGGCGGAGACTCTAGGCGTCGCCTCTCCGCTTCCATTGA
AGCAATATGCAAGAGAAGATTCCGAAGAAACAGCAAAGGCGGTGGCAGACCGGATATGGTGAAACCTTTTAATATCATCA
ATTTTCCGACAGGAGACAAAAACAGTAATTGTTGTTGCAGCAAGTTTCAGATCGTAAAGATTCTCTTGTTTATCCTTCTA
TTGGCTACTCTCTTCACCATCATCTATTCCCCTGAAGTTTATCATCATTCCCTTTCCCACTCTTCTTCTAGATGGATATG
GAGAAGACAAGATTCAAGATATGTTTCGGACTCGGACATAAATTGGGACGATGTGACCAAAACCCTTGAGAGCGTCCAAG
AAGGCCGTACGATCGGTGTCTTGAATTTCGATTCTAAAGAGATCCAACGGTGGAGAGACTTAGCCAAGACTAAAGACAAC
GAAGATGAGGAAAACGTTGTCGTACTGGATCTGGACTATGCAGACAAGAACGTAACTTGGGACTCACTCTACCCAGAGTG
GATCGATGAGGAGCAAGAAACAGAGGTTCCTGTTTGTCCCGATCTCCCAAAGATCAAAGTACCTACAAGAAGACTCGATC
TGATCGTCGTGAAGCTTCCTTGTCGGAAAGAAGGGAACTGGTCAAGAGATGTCGGGAGGTTGCATCTGCAGATGGCCGCA
GCAACGGTGGCCGCTGCAGCGAAAGGGTTTTTCAGAGGTCACGTGTTGTTTGTGTCTAGATGCTTTCCGATTCCGAATCT
GTTTCGGTGTAAGGATCTTGTGTCTCGTAGAGGCGATGTTTGGTTATATAAACCTAATCTTGATACCTTGAGAGACAAGC
TCCAGCTTCCTGTAGGTTCTTGTGAGCTCTCTCTTCCCCTCGGCATCAAAGAGAGACCAAGTTTAGGAAACCCTAAAAGA
GAAGCCTACGCTACAATCCTTCATTCAGCTCATGTTTACGTTTGTGGAGCCATTGCGGCGGCTCAGAGCATAAGACAGTC
CGGTTCAACAAGAGACCTCGTGATCCTGGTCGATGACAACATCAGCGGTTACCACCGAAGTGGACTCGAAGCTGCGGGGT
GGCAAATCAGGACGATACAGAGGATTCGAAACCCTAAAGCGGAGAAAGATGCTTACAACGAGTGGAACTACAGCAAATTC
CGACTATGGCAGCTCACTGATTACGACAAGATCATCTTCATCGACGCAGATCTCTTAATCTTGAGAAACATCGATTTATT
GTTCTCGATGCCTGAGATCTCAGCTACGGGAAACAATGGAACCCTATTCAACTCGGGAGTTATGGTGATTGAGCCTTGCA
ACTGTACGTTTGAGCTTTTGATGGAACATATAAATGAGATTGAGTCGTACAACGGTGGAGATCAAGGTTACTTAAACGAG
GTCTTCACATGGTGGCATCGGATTCCCAAACACATGAATTTCTTGAAGCATTTTTGGGTCGGGGATGAAGATGACGTGAG
ACGCAAGAAAACAGAGTTGTTTGGAGCAGAGCCTCCTATTCTTTATGTTCTTCATTACTTAGGAATGAAACCGTGGCTAT
GTTACCGTGACTATGACTGTAACTTCAACTCCGACATATTCGTTGAGTTCGCGACGGATATTGCTCACCGACGATGGTGG
ATGGTCCACGACGCAATGCCAAAGGAGCTTCACCAATTCTGTTACTTGCGATCCAAGCAAAAGGCACAGCTGGAATATGA
TCGCCGGCAAGCCGAGGCCGCAAACTACACCGACGGCCACTGGAAAATAAGAGTAAAGGACCCAAGATTCAAGATTTGCA
TTGATAAATTGTGTAACTGGAAAAGCATGTTGAGGCATTGGGGAGAATCAAATTCAAATTGGACCGACGACGAGTCTTTT
GTACCTACCCCACCGGCTATCACCGCCGTCCGGAGATCCTCGCTTCCCGGCCATAACTTGTGA