Details for Chinese cabbage Locus Brara.A02915

Position : A01 ( 5`- 24880646 .. 24882122 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02915

Protein [Map View]
MGTETYITVPSFFKCPISLDVMRSPVSLCTGVTYDRASIQRWLDGGNNTCPATMQVLRTKEFIPNLTLQRLIKAWSDSLG
RYAAASPPPDPTTDEVNESLRRLSLEKDDEIRLEILVRFVKDWDANRARKDLVPMLVDIIAGGTRTTTKTKLVLLAIKIL
NSIIKGGSEGDRKRLSNLMLTNGDGDCLTEILLAIQRGNLESKIESVRVLEVISSIDTQTKLIVAERDEILTEVIESIST
ESDPSLIEASLSFLITIAKSKRVRSKLITAKTITKIKDILLTEEITSVAVTEKSLKLLETLSSKREGRSEICGGDGGRCV
EGVVRKLLKVSTTATEHAVTILWCLCYVFGEDKRAEETVERSNGVTKLLVVIQSNCSPMVRQMAKDVIKVLKVKPSASDL
VAYETTTTHIMPF*

DNA
ATGGGAACCGAGACGTACATTACGGTTCCTAGCTTCTTCAAGTGTCCGATATCTCTCGACGTGATGAGATCTCCCGTTAG
TCTCTGCACCGGCGTTACTTACGACCGTGCAAGTATCCAGCGGTGGCTCGACGGTGGCAACAACACTTGTCCCGCCACTA
TGCAGGTTCTCCGAACTAAGGAGTTTATTCCCAATCTCACTCTTCAACGACTAATCAAAGCCTGGTCCGATTCCCTCGGC
CGTTACGCCGCCGCTTCTCCGCCTCCGGATCCGACGACGGACGAAGTGAATGAGTCGTTGCGGAGACTGAGCCTCGAGAA
GGACGACGAGATTCGTCTGGAGATTTTGGTTAGATTCGTGAAGGATTGGGACGCGAACAGAGCGAGAAAGGATCTCGTAC
CAATGCTCGTCGATATCATCGCCGGAGGGACACGCACGACGACGAAGACCAAGCTAGTTCTTCTCGCGATTAAGATTTTG
AATAGTATAATCAAAGGAGGTAGTGAAGGAGATCGGAAACGGTTATCGAATCTAATGTTAACAAACGGTGACGGCGATTG
CTTAACGGAGATTCTCCTCGCGATCCAGCGCGGGAATCTGGAATCGAAAATCGAATCCGTTAGAGTTTTGGAGGTTATCT
CTTCGATAGACACGCAAACGAAGCTAATAGTCGCAGAGCGCGACGAGATTCTCACGGAGGTGATCGAATCAATCAGCACC
GAGTCAGATCCTTCCTTGATCGAAGCGAGTTTATCATTCCTAATCACGATCGCGAAATCGAAACGAGTGAGGTCGAAACT
AATCACCGCGAAAACTATCACGAAGATCAAAGACATTCTCCTAACGGAGGAGATAACCAGCGTCGCGGTGACGGAGAAAT
CGCTGAAACTGTTGGAGACTCTGTCGTCGAAGCGAGAAGGTAGATCGGAGATTTGCGGCGGAGACGGAGGTAGATGCGTG
GAAGGAGTGGTGAGGAAGCTGTTGAAAGTTTCGACGACGGCGACGGAGCATGCAGTTACGATTTTGTGGTGTCTCTGCTA
CGTGTTCGGGGAAGATAAGAGGGCGGAGGAGACGGTGGAGAGAAGTAACGGCGTGACGAAGCTTTTGGTTGTGATACAGA
GCAACTGCTCGCCGATGGTGAGGCAGATGGCGAAAGATGTGATTAAGGTTTTGAAGGTTAAACCATCTGCTTCCGATTTG
GTTGCTTACGAGACCACGACCACTCATATTATGCCATTTTGA