Details for Chinese cabbage Locus Brara.A02914

Position : A01 ( 5`- 24871984 .. 24872271 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02914

Protein [Map View]
MVPPHPHYWRKRIPLNPQPQVLLLLVICFFFVHHCDASRASSPSSVSYRNPNNDHNRNTMRRGHFLGFLPRHFPVPASGP
SRKHNDIGIQALLSP*

DNA
ATGGTTCCTCCACATCCGCATTACTGGAGAAAAAGAATACCACTAAACCCACAACCACAAGTTCTTCTTCTTCTGGTCAT
CTGCTTCTTCTTCGTCCACCACTGCGACGCCTCGAGAGCCTCGTCTCCATCAAGCGTTTCCTACAGAAATCCTAATAATG
ACCACAACAGAAATACCATGAGGAGAGGTCATTTCTTGGGGTTCTTGCCAAGACACTTCCCTGTTCCAGCTTCTGGTCCT
TCACGAAAACACAACGACATTGGTATACAAGCCTTGTTGTCTCCATGA