Details for Chinese cabbage Locus Brara.A02913

Position : A01 ( 5`- 24868054 .. 24868571 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02913

Protein [Map View]
MVAAKKTKKSHEGINSRLALVMKSGKYTLGYKSVLKSLRSSKGKLILISSNCPPLRRSEIEYYAMLAKVGVHHYNGNNVD
LGTACGKYFRVSCLSIVDPGDSDIIKSLP

DNA
ATGGTTGCGGCAAAGAAGACGAAGAAGTCCCATGAGGGAATCAACAGCAGATTAGCTCTGGTCATGAAGAGTGGCAAGTA
CACTCTTGGCTACAAATCTGTCCTCAAGTCCCTTCGCAGCTCCAAAGGTAAGTTGATTCTTATCTCTAGCAACTGCCCTC
CGTTGAGGAGATCAGAGATTGAGTACTACGCTATGCTTGCTAAAGTTGGTGTTCATCACTACAATGGTAACAATGTCGAT
TTGGGCACTGCTTGTGGAAAGTACTTCCGTGTCTCATGTCTCAGCATTGTTGATCCTGGTGATTCCGACATCATCAAGTC
ACTTCCT