Details for Chinese cabbage Locus Brara.A02912

Position : A01 ( 5`- 24861104 .. 24863687 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02912

Protein [Map View]
MNRSSSNSEGAKAEQIIFEFFAKSLHIILESRTPFMSSRNFSGDQMICSPSPSSSSSSSSSVRPRDKWFNLALRECPAAL
ESFDIGRRSSLEPLVVDVVLVARQPFQMSLSDQDELACETKNEQVIERWLVQYDNRKGREAAASRSSSSNSKLQVMYKKA
TLLLRSLFVMVRLLPAYKIFRELNSSGQICKFKLVPKVPTIVEPFTRREEAEMQKFAFAPVDTVCGRLCMSVMYRSLSDV
SCEHSAPVSPTFITDYVGSPLADPLKRFPSLPLSYGSPPLLAFQRRHSWSFDRFKASSPPPSVSCSPSPTRSDSQALVRR
LPDIPTGRRKDEERDFSPPCSPSGPVSRGITRTESAPVRIPAPSFESKQNLVAPSPRLKLLRQASLKPVRNSGGAVESGA
GLDKLFLYGREDFRRSSGVRLSTNSSPRISFSRSSSRSYQEDFDDNDFPCPFDVEYDEITDPSSIPGSFDQRGDIHEPPL
ESSGSYPKKSQDAAVGALVNMLKKAPPLRQDVSESSIPEIYWNYNNKKPAGAHEVAAASMTASGIALAAKTTADALEELR
SYKEMKNVLLSQSTMGSSSVTTSPFAVSGS*

DNA
ATGAACAGGAGTAGCAGCAATTCAGAAGGTGCTAAAGCAGAGCAGATCATATTCGAGTTCTTCGCCAAAAGCCTCCACAT
CATCCTCGAATCAAGGACTCCTTTCATGTCTTCCCGAAACTTCAGCGGCGACCAGATGATCTGCTCCCCTTCCCCTTCCT
CCTCCTCCTCATCTTCCTCTAGCGTCAGGCCCCGCGACAAATGGTTCAACCTAGCCCTCAGAGAATGCCCTGCAGCCTTA
GAGAGTTTCGACATCGGCCGCAGAAGCAGCCTCGAGCCTCTGGTCGTCGATGTAGTTCTTGTAGCGAGACAACCATTTCA
GATGAGTTTGTCAGATCAAGATGAGTTAGCGTGTGAGACAAAGAACGAGCAAGTTATAGAGAGGTGGTTGGTGCAGTACG
ATAACAGAAAGGGTAGGGAAGCTGCTGCTTCCAGGTCGAGTAGTAGTAACAGTAAGCTGCAAGTGATGTATAAGAAAGCG
ACTTTGCTGCTGAGATCACTCTTTGTGATGGTTAGGCTTTTGCCTGCTTACAAGATCTTCCGGGAACTCAACTCCTCCGG
ACAGATCTGCAAGTTTAAGCTCGTCCCTAAGGTCCCCACCATTGTCGAGCCGTTCACTCGGAGAGAAGAGGCGGAGATGC
AGAAGTTCGCTTTTGCTCCGGTTGACACCGTCTGCGGTAGGCTTTGCATGTCGGTGATGTATCGCTCTCTCTCTGACGTC
AGCTGTGAGCACTCGGCTCCTGTCTCTCCGACGTTTATAACGGACTACGTTGGGAGTCCTTTGGCTGATCCGTTGAAGAG
GTTCCCTTCTCTGCCTCTCTCTTACGGTTCGCCTCCGTTGCTGGCGTTTCAGAGGCGGCATAGCTGGAGTTTCGATAGGT
TCAAGGCCTCCTCTCCTCCGCCTTCGGTTTCTTGCTCGCCGTCTCCTACACGGTCGGATTCGCAGGCGTTGGTTCGTCGT
CTTCCTGATATACCTACTGGTCGTAGGAAGGATGAAGAGAGAGACTTCTCCCCTCCTTGCTCTCCTTCGGGACCTGTCTC
GAGAGGTATCACGCGTACTGAGAGTGCTCCGGTTAGAATCCCGGCTCCTAGTTTTGAGTCCAAGCAAAACTTGGTGGCGC
CTTCTCCTCGTTTGAAACTGTTGAGACAGGCTTCTTTGAAGCCTGTGAGGAACAGTGGTGGTGCTGTTGAATCTGGAGCA
GGATTGGATAAGCTGTTTCTTTATGGGAGAGAAGACTTTAGGAGGAGCTCTGGAGTGAGGCTGTCTACCAACAGCTCACC
GAGGATATCGTTTTCTCGAAGTTCGAGTAGATCATACCAAGAAGATTTTGATGATAATGACTTCCCTTGCCCGTTTGATG
TTGAGTATGATGAGATTACTGATCCTAGCAGCATACCAGGGTCTTTCGACCAGAGAGGAGATATACATGAACCACCACTT
GAGTCAAGCGGCTCCTACCCAAAGAAGTCGCAAGATGCTGCAGTTGGTGCTCTTGTGAATATGCTGAAGAAAGCTCCGCC
TCTCAGACAAGACGTCTCTGAATCTTCCATACCTGAGATTTACTGGAACTACAACAACAAGAAACCTGCAGGGGCTCACG
AGGTGGCAGCGGCGTCTATGACAGCGTCGGGGATTGCTCTGGCGGCGAAGACAACAGCGGATGCGTTGGAAGAGTTGAGG
TCGTACAAGGAAATGAAGAATGTGTTGCTTAGCCAATCCACAATGGGTTCTTCCTCTGTCACTACTTCACCCTTTGCTGT
TTCAGGATCTTGA