Details for Chinese cabbage Locus Brara.A02911

Position : A01 ( 5`- 24845441 .. 24846070 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02911

Protein [Map View]
MYSEVFQEHFISRKLLQQLPFDHNMHQQEAHVPDKNNLSGNVLMVLSILVCGIIGSLGLHYVIGCIFRRSSSFMIADPIS
SPSTPRGSATANKGIKKKALKMFPVTKYSPEMNLSGLGEECVICLSDFVAGEQVRLLPKCNHGFHVRCIDKWLKQHVTCP
KCRHCLVETCQKILGDEADQVVATPTEMIYVMIAPLEREARVNTYRENS*

DNA
ATGTATTCTGAAGTCTTCCAAGAACATTTCATCTCCAGAAAGTTGCTTCAGCAACTGCCATTTGATCACAACATGCACCA
ACAAGAAGCTCATGTACCTGACAAGAACAACTTGAGCGGCAACGTTCTCATGGTTCTATCTATCCTTGTCTGCGGTATCA
TCGGCTCCCTCGGGTTGCATTACGTAATCGGTTGCATATTCAGACGTTCCTCGAGTTTCATGATCGCTGATCCCATCTCT
AGCCCGTCCACACCACGTGGCTCAGCAACAGCAAACAAAGGGATCAAGAAGAAAGCTCTAAAGATGTTCCCGGTAACAAA
ATACTCACCTGAGATGAACCTCTCAGGGCTAGGTGAGGAGTGTGTCATTTGCTTGTCTGATTTCGTAGCTGGAGAACAGG
TACGGCTGCTTCCAAAGTGTAATCATGGCTTCCACGTTCGCTGCATCGACAAGTGGCTTAAGCAGCATGTGACTTGTCCG
AAATGCAGACACTGTCTGGTTGAGACATGCCAAAAGATCTTAGGCGATGAAGCTGATCAGGTTGTAGCAACACCAACGGA
GATGATATATGTCATGATTGCTCCTCTTGAACGTGAAGCAAGAGTAAACACTTATAGAGAAAACAGCTAG