Details for Chinese cabbage Locus Brara.A02902

Position : A01 ( 5`- 24720762 .. 24723624 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02902

Protein [Map View]
MTTTNSIHNRSRSDPLLKKSLKTNKSSEATHNIDRFHMDQTLQREIEQLKSLVKCRKLQPQGVSCDEIDLLLQEDELLVR
GELETVLRRKLFLEDCRNEDPSIPKEAKKLVSEIAGLELQVMYLERYLLLLYRRFFNNRVSSNLEPEEKEISEDLLVSTN
LIESPKTAVCSPQKVLEDSGIFRSHSSLSHCSGYSFRMSPQAMDSSYHHSLPFSMLEQADIDVMVGTYVSENVTKSPNSL
SEEMIKCISEVFRKLGNQESLDDDQESSSPFRRKGKLKVTSRPYDKLLMVKSLCRDSEKLNEVEPALKHFRSLVNKLEGV
NPRKLNHEEKLAFWINIHNSLVMHSILVYGSPKNSMKRVSGLLKAAYNVGGRSLNLDTIQTSILRCRVSRPGQVFRFLFA
SKPKGKAGDLGKDYAITHPEPLLHFALCSGNFSDPSVRTYTPKNVMMELECGKEEYVRSNVGISKDNKILLPKLVELYAK
DTELCHVGIHDMIANHLPCDARNNIHQCVNKKHGRFTIDWVAHDFRFRLLL*

DNA
ATGACAACAACAAATTCGATTCACAACCGTTCAAGAAGTGATCCACTCCTCAAAAAATCTCTCAAAACCAACAAATCAAG
TGAAGCCACTCACAACATCGATAGATTTCACATGGATCAAACGTTGCAGAGAGAGATAGAACAGCTCAAATCTCTTGTAA
AATGCAGAAAACTACAGCCCCAGGGAGTGTCATGTGATGAGATTGATTTGCTGCTTCAAGAAGATGAACTTTTAGTACGG
GGTGAGTTGGAGACAGTTCTCAGACGCAAACTGTTCTTGGAAGATTGTAGAAACGAAGATCCTTCTATCCCCAAGGAAGC
AAAGAAACTGGTGAGCGAAATCGCAGGCTTGGAGCTGCAAGTGATGTACTTAGAAAGATATCTTCTTTTGTTATACCGAA
GGTTCTTCAACAACAGAGTTTCAAGTAACTTAGAACCAGAGGAGAAAGAGATATCAGAGGATCTTCTTGTGTCTACTAAT
CTCATTGAGTCCCCAAAAACTGCGGTCTGCAGCCCGCAGAAAGTTCTAGAGGACTCTGGAATATTCCGCAGCCATTCATC
GTTGTCTCATTGTTCAGGCTATTCCTTTAGAATGTCTCCCCAAGCAATGGACTCATCATACCATCACTCTCTTCCTTTCT
CAATGCTTGAGCAAGCTGATATCGATGTGATGGTTGGGACATATGTTTCTGAAAATGTTACCAAATCACCAAATAGTTTG
TCTGAAGAGATGATCAAGTGTATCTCAGAAGTATTTCGTAAACTTGGGAATCAAGAATCATTGGATGATGATCAAGAATC
TAGTAGTCCATTTCGCAGAAAGGGGAAGCTGAAGGTTACTAGCCGGCCTTACGATAAGTTACTAATGGTGAAATCTCTAT
GTAGAGACTCTGAGAAGTTAAATGAAGTTGAACCTGCTTTAAAGCATTTCAGGTCGCTTGTTAATAAGTTAGAAGGAGTT
AATCCAAGGAAGTTGAATCATGAAGAGAAGCTAGCTTTCTGGATCAACATACACAACTCTTTGGTTATGCATTCGATTCT
TGTCTATGGGAGCCCTAAAAACAGTATGAAAAGAGTATCTGGATTGTTGAAGGCAGCGTATAACGTTGGAGGACGAAGCT
TGAACTTAGATACAATTCAGACTTCGATTCTTCGTTGCCGTGTCTCTCGTCCAGGACAGGTATTTAGGTTCTTGTTTGCT
TCTAAACCAAAGGGTAAAGCTGGAGACTTGGGTAAAGATTATGCTATAACTCACCCTGAGCCTCTTCTTCATTTCGCGCT
ATGCTCTGGGAACTTCTCAGATCCATCAGTCCGTACTTATACGCCAAAAAACGTGATGATGGAGCTAGAATGTGGCAAAG
AAGAGTATGTAAGATCAAACGTAGGAATATCCAAAGACAACAAGATTCTTTTGCCGAAGCTGGTTGAGTTATATGCTAAG
GACACTGAACTTTGCCATGTCGGCATTCACGACATGATCGCGAACCATCTGCCTTGTGATGCAAGAAATAATATCCACCA
GTGTGTGAACAAGAAGCATGGAAGATTCACCATCGATTGGGTCGCACATGATTTCAGATTCAGGTTGCTTCTTTGA