Details for Chinese cabbage Locus Brara.A02900

Position : A01 ( 5`- 24697427 .. 24700531 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02900

Protein [Map View]
MPRPFFHKLIFSSTIQEKRLRVPDKFVSKFKDELSVAVALTVPDGHVWRVGLRKADNNKIWFQDCWQEFVDRYSIRIGYL
LIFRYEGNSAFSVYIYNLSHSEINYHSTGLMDSAHNHFKRARLFEDLEDEDVEVVHPSSLYPSQHPETTAHANKGHTSSA
IQSFFAEPPVKAEETTPTPKVPKKRGRKKKNADPEEINSSAPRDDDPENRSKFYESASARKRTVTAEERERAINAAKTFE
PTNPFFRVVLRPSYLYRGCIMYLPSGFAEKYLSGISGFIKVQLGEKQWPVRCLYKAGRAKFSQGWYEFTLENNLGEGDVC
VFELLRTRDFVLKVTAFRVNEYV*

DNA
ATGCCACGCCCTTTCTTCCACAAGCTGATTTTCTCATCCACTATCCAAGAAAAACGTCTGAGAGTTCCAGATAAGTTTGT
GAGTAAATTCAAGGACGAGCTATCGGTTGCAGTTGCACTCACAGTACCTGATGGTCATGTTTGGCGTGTAGGACTAAGGA
AAGCTGACAACAACAAAATCTGGTTTCAAGATTGTTGGCAAGAGTTTGTTGACCGTTACTCAATCCGCATTGGTTACCTT
TTGATTTTTAGATACGAAGGCAACTCTGCCTTCAGCGTCTACATTTACAACTTATCACACTCCGAGATCAACTACCATTC
CACCGGTCTCATGGATTCTGCGCACAACCACTTCAAACGTGCGCGTTTGTTTGAAGACCTCGAAGATGAAGATGTTGAGG
TTGTTCATCCTTCTTCTTTGTACCCATCACAGCATCCTGAGACTACTGCGCACGCTAATAAAGGGCATACTAGTTCAGCT
ATCCAGAGCTTCTTCGCTGAACCACCTGTTAAAGCTGAAGAGACAACACCAACCCCAAAAGTTCCTAAAAAGAGAGGGAG
GAAGAAGAAGAACGCTGATCCTGAGGAAATAAATTCATCTGCTCCACGAGATGATGACCCAGAGAACCGTTCAAAGTTCT
ACGAGAGTGCTTCTGCAAGAAAGAGAACCGTGACTGCAGAGGAAAGGGAGAGAGCCATCAATGCAGCCAAAACGTTCGAG
CCAACAAACCCTTTCTTCAGAGTTGTTCTACGACCGTCCTATCTATACAGAGGTTGCATCATGTATCTGCCGTCAGGGTT
TGCTGAGAAGTATTTAAGCGGGATCTCGGGATTCATCAAGGTCCAGCTCGGGGAGAAACAATGGCCAGTGAGATGCCTCT
ACAAAGCAGGGAGAGCCAAGTTCAGCCAAGGATGGTACGAGTTCACTCTTGAGAACAACCTTGGAGAAGGTGACGTCTGC
GTGTTCGAGCTGCTCAGAACCAGAGACTTCGTTCTCAAAGTGACGGCCTTTCGTGTCAACGAGTACGTCTGA