Details for Chinese cabbage Locus Brara.A02898

Position : A01 ( 5`- 24665553 .. 24665991 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02898

Protein [Map View]
MVSQKLEICIELVKFAVVFVATVAESVEKAFRKPLPALPAVHDGSRNSYSAVPIPLVGFM*

DNA
ATGGTGTCTCAAAAGCTGGAGATTTGCATCGAATTAGTGAAGTTTGCCGTCGTTTTTGTAGCCACCGTGGCTGAATCAGT
AGAAAAGGCTTTCCGGAAGCCTTTGCCGGCGCTTCCAGCAGTTCATGATGGTAGCCGGAATAGTTACTCGGCCGTTCCCA
TTCCTCTTGTTGGATTCATGTGA