Details for Chinese cabbage Locus Brara.A02897

Position : A01 ( 5`- 24652941 .. 24661664 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02897

Protein [Map View]
MAERNEGSSEDDEEYADRSRGLEFIFGNVDNSGDLDADYLNEDAKEHLSALASSLPDIMLMASSGCTTSDPAEQDYNEKA
ADAVDYGDIDEEYDGPEVQVVTEEDHLLPEREYFSSAAASGSLYSKASVFDDDDYDEEEEQEVEHMPFEETFDSEDSESV
VLKEDNALEYEEEASILGNEERLDTNEKNATSLPTLYVEDGMVVLQFSEIFAIHKPPQKRAKRENRYITYRDRYKSMELV
EDDEGLLLKSHGRVDTHVKQADLIQLDVPLPIRGDLQLVKAGTFGSIIPESREFTKPGRDSCTMGELLKQDLQDDKSSLC
QSQSSMEVFPLDQQEWENRIIWENSPGVSGNSCESFESGIESESLLIQGTNSETEQESLNVVNSGEQAQAENNKHVSFFV
SGLESLGSHTTSESTNKSRRHPQLLRLESQWDEDHPSENDNTGGKNLKQLKRDTVGRFSRVGLQERDMGDDPWLDSIIWE
SDKELTRSKLIFDLQDEQMVFEIPDNGESKDLQLHAGSMILSRSSKPKDKRFQEGCGSNYGFQFNISNDKFYMNGKSCQQ
LQANANQFGVHSLRVLHSASAIKLQTMKNKLSNKDIANFHRPKALWYPHNNELAIKQQGKLPTQGFMQIVVKSLGGKGIR
IHVGIEESVSSLKAKASRKLDFKETEAVKIFYMGKELEDEKSLAEQNVHPNSLVHILRTKVHLLPWAQKLPGEHKSLRPP
GAFKKKSDLSTKDGHVFLMEYCEERPLMLSNAGMGANLCTYYQKSSPADQHGNLLCDKNDTLGNVMILEPGEKSPFLGEI
HGGCSQSSIETNMYKAPVFPHKLQSTDYLLVRSSKGKLSLRRIDKTFAVGQQEPRMEVMSPASKNLQTYLVNRMLVYVDR
EFKHRRRIPADELSFLFSSLSDAVVKKTMRIHGIFLERDKNGHIFWYKKHRFDKIPNEIELKNLVAPEDVCSYESMLAGL
YRLKHLGITQFTLPASISTALAQLPDEAIALAAASHIERELQITPWNLSSNYVACTTQDRANIERLEITGVGDPSGRGLG
FSYVRAAPKVPAAAGRMKKKEAACCGAPTVTGTDADLRRLSREAAREVLRKFNVPDEKMAKQNRWHLIAMIRKLSSEQAA
SGVLKVDPTTIGKYARGQRMSFLQLQQQAREKCQEIWDRQLLSLSACDDDESESENDMDSFVGDLENLLDAEEWEESNTS
KNDKFDGVNGFKMRRRPYQVVTDEDVEDEAAEYAELRRLLMKDDEKRNMNAEFVRKDSVSAKKHIASRPDASFLVTKSTF
SKNTANVSVFKERKPVRDNFFCGACGQPGHMKTNKHCPKYRSTTEPQPEGIYVKKSSGTPSSSDLSGQVKLEPTKSKKTA
PKSPTKVSVDEAPKGDNPTSKTGGLTLRFKCAIPAGGMLDKPGSETPRRSMEEPDRPLPSLMPAFIRERGESESHRPSVS
GQSFSNTERNQAASSRLTMSTTQPSLRMDKELVIQRPNEREQPQKKLVIKRSKVITDSLTLSSQFESRKTMRMAEPEGFQ
SRQRFRLSENSPHGGPKEGRVWQEEREISTERHREARVRRDYADMTEFEKANEIGSEREEKERQKKLQPEVIERYLEGYP
RRRNDRKLLERVQKVRSQYVSDFERNVAQYAPQPKRRKKGEVGLANILEVIVDTLRAKEVNVSYLFLKSVSKKEAPDYHD
VVQRPMDLSTIRDKVRRVEYRDREQFRNDVWQIKYNAHLYNDGRNPMIPPLADELLVKCDGLLERYRDELTEAEKGIVNL
ID*

DNA
ATGGCTGAACGCAACGAGGGTTCTTCAGAGGACGATGAAGAGTATGCGGACAGAAGCAGGGGACTGGAGTTTATCTTTGG
AAACGTTGATAACTCTGGTGATTTGGATGCTGATTACCTTAATGAGGACGCCAAGGAACATCTTTCTGCATTGGCTTCGT
CTCTTCCAGACATAATGCTGATGGCAAGTTCAGGATGTACAACAAGTGATCCAGCTGAACAAGATTACAACGAAAAAGCT
GCGGATGCTGTTGATTATGGGGATATTGATGAAGAGTATGACGGGCCTGAAGTTCAAGTAGTTACTGAGGAAGATCATCT
ACTGCCAGAAAGAGAGTATTTTTCGTCTGCAGCTGCCTCGGGTAGTTTATATTCCAAAGCTTCTGTGTTTGATGATGACG
ATTATGATGAGGAAGAAGAACAAGAGGTGGAGCACATGCCATTTGAAGAAACTTTTGATTCTGAAGATAGTGAATCAGTT
GTCTTAAAGGAAGACAACGCGTTGGAGTATGAAGAGGAGGCTTCCATCTTGGGAAATGAGGAACGATTGGACACAAATGA
GAAAAATGCAACGTCACTGCCTACCCTGTATGTTGAAGATGGTATGGTCGTCTTACAATTCTCTGAGATATTTGCTATTC
ATAAGCCACCACAGAAACGAGCAAAAAGAGAAAATAGATATATCACTTACAGAGATAGATACAAATCTATGGAGCTTGTT
GAAGATGATGAGGGGTTACTTCTTAAGAGCCATGGTAGGGTCGACACTCATGTGAAACAAGCTGATCTGATTCAGCTGGA
TGTTCCGTTACCAATAAGAGGGGATTTACAGCTGGTAAAAGCTGGCACATTCGGAAGCATCATACCAGAATCGAGAGAAT
TTACCAAGCCAGGACGGGATTCATGCACCATGGGTGAACTGTTGAAGCAGGACTTACAAGACGATAAATCATCTCTGTGC
CAGTCACAATCATCAATGGAAGTTTTTCCTCTTGACCAGCAAGAATGGGAAAATCGAATTATTTGGGAAAATTCTCCTGG
AGTTAGTGGTAATTCTTGTGAAAGCTTCGAATCTGGAATTGAGTCAGAAAGCCTGCTTATTCAAGGAACAAACTCAGAGA
CTGAACAAGAAAGCTTAAACGTGGTGAATTCTGGAGAGCAAGCTCAAGCTGAAAATAATAAGCATGTATCTTTTTTTGTC
AGTGGCTTGGAGTCTCTTGGTTCACACACTACTAGTGAGTCCACTAACAAAAGTAGACGTCATCCGCAACTCCTTAGGTT
AGAATCTCAGTGGGATGAGGATCATCCTAGTGAAAATGACAATACTGGAGGGAAGAATTTAAAGCAGCTTAAAAGGGACA
CTGTTGGACGCTTTAGCAGAGTTGGATTGCAAGAGAGGGATATGGGGGATGACCCATGGTTAGATAGCATAATTTGGGAG
TCAGATAAAGAGTTGACCAGGTCTAAACTAATATTTGACCTTCAAGATGAGCAAATGGTCTTTGAAATCCCGGATAACGG
GGAAAGCAAAGATCTTCAACTTCATGCTGGATCTATGATTCTATCCCGGTCTTCAAAGCCCAAGGATAAAAGATTTCAGG
AAGGCTGTGGCTCAAATTATGGGTTCCAGTTCAATATTTCTAATGACAAGTTCTATATGAATGGGAAAAGCTGTCAGCAA
CTGCAAGCAAATGCTAATCAATTCGGCGTACACAGTTTGAGAGTTCTTCATTCAGCGTCAGCGATTAAATTACAGACAAT
GAAGAACAAATTGAGCAATAAAGACATAGCAAATTTTCACCGGCCCAAAGCTTTATGGTATCCACATAACAATGAGCTAG
CGATCAAGCAGCAAGGAAAGTTACCAACCCAAGGATTTATGCAAATTGTAGTTAAGAGTCTGGGGGGTAAAGGAATCAGG
ATACACGTTGGCATAGAGGAATCTGTCTCTTCTTTAAAAGCCAAGGCTTCTAGGAAGCTAGATTTTAAGGAAACTGAAGC
AGTGAAGATTTTTTATATGGGAAAGGAACTTGAGGATGAAAAGTCTCTTGCTGAACAAAATGTACATCCAAATTCTTTGG
TCCATATTTTACGCACCAAGGTACATCTGTTACCATGGGCACAAAAGCTTCCTGGCGAACATAAATCTTTGAGACCTCCG
GGGGCATTCAAGAAGAAATCAGACCTATCTACTAAAGATGGCCATGTTTTCTTAATGGAATATTGTGAAGAGAGGCCCTT
GATGCTCAGCAATGCAGGAATGGGTGCAAATTTGTGCACGTATTATCAGAAGTCATCCCCAGCGGATCAGCATGGAAACC
TGCTGTGCGATAAAAATGACACTTTAGGGAATGTGATGATTCTAGAACCTGGGGAGAAATCTCCTTTCCTTGGGGAAATA
CATGGTGGCTGCAGTCAGTCATCTATCGAAACAAACATGTACAAAGCACCTGTTTTTCCACATAAGTTGCAATCAACGGA
TTATCTGTTGGTCCGGTCTTCTAAAGGAAAGCTCTCTCTAAGGCGTATTGACAAGACATTTGCTGTTGGACAACAGGAAC
CTCGAATGGAAGTAATGTCTCCTGCATCAAAGAATCTGCAGACTTATTTGGTGAACAGGATGTTGGTCTATGTGGACCGA
GAATTTAAGCATCGCCGCCGTATTCCTGCAGATGAGCTGTCTTTCTTATTTTCTAGCTTATCCGATGCAGTAGTCAAGAA
GACCATGAGAATTCATGGTATTTTTCTTGAGAGGGATAAAAATGGCCATATTTTCTGGTACAAGAAACATAGGTTTGACA
AGATTCCAAATGAGATTGAGTTGAAAAATCTTGTGGCACCAGAGGATGTGTGTTCCTATGAGAGTATGCTAGCTGGGCTG
TACCGGCTCAAACATTTAGGGATCACCCAGTTTACATTGCCTGCCAGCATATCAACTGCATTGGCTCAGCTCCCAGATGA
AGCCATTGCTCTTGCCGCTGCTTCACATATTGAGAGGGAGCTGCAGATTACTCCGTGGAATTTGAGTAGTAACTATGTTG
CTTGTACAACTCAGGACAGAGCAAATATAGAGCGTTTGGAAATTACTGGAGTTGGCGATCCCTCTGGACGAGGTCTAGGA
TTCAGCTACGTCCGAGCTGCGCCAAAAGTGCCAGCTGCAGCTGGTCGTATGAAGAAAAAGGAAGCAGCGTGTTGCGGAGC
CCCAACTGTAACTGGTACAGATGCTGATCTTCGCAGATTAAGCAGGGAAGCAGCTCGAGAGGTTCTTCGCAAGTTCAATG
TTCCTGATGAGAAAATGGCCAAGCAAAATCGATGGCACCTGATAGCTATGATACGCAAGCTATCGAGTGAGCAGGCTGCA
TCTGGTGTACTTAAGGTTGATCCTACGACAATAGGTAAGTATGCCCGTGGCCAGAGAATGTCTTTCCTACAGTTACAACA
GCAGGCCCGGGAAAAGTGTCAGGAGATTTGGGATAGGCAACTTCTGTCCCTTTCAGCTTGTGATGACGATGAGTCTGAGA
GTGAAAATGACATGGACTCCTTTGTCGGAGATCTGGAAAATCTACTCGATGCTGAGGAGTGGGAAGAATCTAATACGTCT
AAAAATGACAAGTTTGATGGAGTCAACGGATTCAAAATGAGACGGCGGCCATATCAAGTTGTGACAGACGAAGATGTTGA
AGATGAAGCTGCTGAATATGCCGAGTTACGCCGATTGCTGATGAAAGATGACGAAAAAAGGAATATGAATGCTGAATTTG
TCAGAAAGGACAGTGTCAGTGCCAAGAAACATATTGCCTCCCGTCCTGATGCATCTTTCTTAGTTACTAAGAGCACCTTT
TCCAAAAACACAGCAAACGTCAGTGTATTCAAAGAAAGAAAACCAGTGAGAGATAACTTCTTCTGTGGAGCCTGTGGTCA
GCCTGGACACATGAAAACCAATAAGCACTGCCCAAAATACAGATCAACTACAGAACCACAGCCTGAAGGTATATATGTGA
AGAAGTCTTCTGGGACACCGAGTTCTTCAGATCTATCAGGCCAGGTCAAGCTGGAACCTACCAAAAGCAAAAAGACCGCG
CCAAAAAGTCCAACAAAAGTTTCTGTAGATGAAGCTCCGAAGGGAGATAATCCAACTTCCAAAACCGGAGGTCTTACCCT
GAGGTTTAAATGTGCTATACCCGCTGGAGGGATGTTAGATAAACCCGGTTCTGAAACTCCAAGACGCTCTATGGAAGAAC
CTGATAGACCTTTACCTTCATTGATGCCTGCATTTATCAGAGAGAGAGGGGAGAGCGAGTCTCACAGGCCTTCTGTTTCT
GGACAATCATTTTCTAATACAGAGAGAAATCAGGCTGCATCAAGCAGGCTTACTATGTCAACCACGCAGCCATCATTACG
CATGGATAAAGAACTTGTGATACAGCGGCCGAATGAAAGGGAACAGCCCCAGAAGAAACTTGTTATAAAACGTTCGAAAG
TGATAACTGATAGCCTTACACTGAGTTCACAGTTTGAGTCCAGGAAGACAATGAGAATGGCAGAACCAGAAGGTTTTCAG
AGTCGGCAGAGATTCAGATTGTCAGAGAACTCACCACACGGGGGACCAAAAGAGGGTAGAGTATGGCAAGAAGAACGGGA
GATAAGTACTGAAAGGCACAGGGAAGCAAGGGTGAGAAGGGATTATGCTGATATGACTGAATTTGAAAAGGCCAATGAGA
TAGGGAGTGAAAGGGAGGAAAAGGAACGGCAAAAGAAGCTGCAGCCGGAAGTAATAGAGAGATATCTAGAAGGTTATCCT
CGTCGAAGAAACGATAGAAAATTGTTAGAAAGAGTTCAGAAAGTCAGAAGCCAGTATGTCTCTGACTTTGAAAGGAACGT
GGCACAGTACGCACCTCAACCAAAACGACGCAAAAAGGGAGAGGTTGGCCTAGCAAACATCTTGGAAGTCATAGTGGACA
CACTAAGAGCCAAAGAAGTAAACGTGTCGTACCTCTTCTTGAAATCTGTTTCGAAGAAGGAGGCTCCGGACTATCATGAC
GTTGTGCAACGCCCCATGGATCTCTCGACAATCAGGGATAAGGTACGGAGGGTAGAGTACAGAGACAGAGAGCAGTTTAG
AAATGATGTCTGGCAGATCAAGTACAATGCTCATCTTTACAACGATGGGCGTAACCCGATGATACCGCCCTTGGCAGATG
AGCTGCTGGTGAAATGTGATGGCTTGTTGGAGAGATATAGAGATGAGTTAACAGAAGCAGAGAAAGGTATAGTAAATCTC
ATTGACTGA