Details for Chinese cabbage Locus Brara.A02896

Position : A01 ( 5`- 24641803 .. 24643798 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02896

Protein [Map View]
MVHVNMRHYTFEIRQIRSHLLLVRHPRPTNLRYLKKMKDSGEFMVEISNLQSVSEMISRIEKRMIELGEDNMKIKK

DNA
ATGGTGCATGTAAACATGAGGCATTATACATTTGAAATCCGTCAAATCCGTTCACATTTACTCCTAGTTCGTCACCCTCG
TCCAACAAACCTGCGATACTTGAAGAAGATGAAGGATTCCGGTGAGTTCATGGTAGAAATCTCAAACCTCCAGTCAGTTT
CGGAAATGATATCAAGAATTGAAAAACGTATGATAGAACTCGGAGAGGACAACATGAAAATTAAAAAA