Details for Chinese cabbage Locus Brara.A02893

Position : A01 ( 5`- 24622159 .. 24623880 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02893

Protein [Map View]
MQALTSFFVSRSLVPTTPRRPRVRPLSVPPMTVCIDQSRNEKVVVIMGSTGTGKSRLSVDLATRFSAEIINSDKMQFYKG
LEITTNQITIPERCGVPHHLLGELPVDGPELTASEFRSLASGFISEMTSRGKLPIIAGGSNSFIHALLVEHFDPETNPFS
KTLIPTELRYDCCFLWVDVSVSVLYHYLSKRVDQMMESGMFEELADFYNSRDSRSTTRTGIHKSIGVPEFDRYFGVYPPE
KNDKVCGWDPARKVAYEEAVQEIKENTWRLSKKQIDRIMKLRSSGWEIHRLDATASFRAQSREAWDKNVLEKSVKIVKRF
VLEN*

DNA
ATGCAAGCACTTACCTCTTTCTTCGTCTCTCGTTCCCTCGTCCCGACCACTCCAAGGCGACCTCGAGTGCGACCACTATC
AGTACCTCCCATGACCGTTTGCATTGACCAATCACGCAATGAGAAAGTGGTTGTCATCATGGGATCCACCGGGACAGGAA
AGTCACGCCTCTCAGTCGATCTTGCAACTCGTTTTTCCGCCGAGATCATCAACTCTGACAAAATGCAATTCTACAAAGGC
TTGGAGATCACGACGAATCAAATCACTATCCCTGAGCGATGTGGAGTTCCTCACCATCTACTCGGTGAGCTTCCTGTGGA
TGGCCCCGAACTAACTGCCTCGGAGTTCCGATCTTTGGCGTCAGGGTTCATCTCTGAGATGACCTCTCGTGGGAAGCTCC
CTATAATAGCAGGTGGATCTAACTCCTTCATTCATGCCCTCCTTGTTGAACATTTTGACCCTGAAACAAATCCATTCTCT
AAAACCTTGATACCTACCGAGTTGAGGTACGATTGCTGCTTCCTCTGGGTGGACGTCTCAGTCTCAGTCCTGTACCACTA
CCTCTCAAAACGTGTCGACCAAATGATGGAATCAGGGATGTTCGAGGAGCTCGCCGATTTCTACAACTCTAGAGACTCCC
GGTCCACAACCCGAACCGGGATTCACAAGTCTATAGGAGTACCGGAGTTCGACCGGTACTTCGGAGTCTACCCGCCGGAG
AAAAACGACAAGGTTTGTGGGTGGGACCCAGCAAGAAAGGTTGCGTACGAGGAAGCAGTTCAGGAGATCAAAGAAAACAC
CTGGAGGCTTTCAAAGAAGCAGATAGATAGGATCATGAAGCTTAGAAGCAGTGGTTGGGAGATTCACAGGTTGGACGCTA
CGGCATCATTCAGGGCACAGTCAAGAGAGGCTTGGGACAAGAACGTTTTGGAGAAAAGCGTCAAGATAGTGAAACGCTTC
GTGCTCGAAAACTAG