Details for Chinese cabbage Locus Brara.A02872

Position : A01 ( 5`- 24390070 .. 24392414 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02872

Protein [Map View]
MGEEIIANDDNSSKTKPSPKLTLLPLVFLIFYEVSGGPFGVEDSVKSGGGPLLALLGFLIFPLIWSIPEALVTAELATSF
PENGGYVVWISSAFGPFWGLQEGFWKWFSGVMDNALYPVLFLDYLKHSFPVLDHAAARVPALLALTFALTYLNYRGLHIV
GFSAVLLAVFSLCPFVVMALLAVPRISPKRWLFVDFKKVNWRGYFNTMFWNLNYWDKASTLAGEVESPGKTFPKALFGAV
LLVMGSYLIPLMAGTGALSESASGEWSDGYFAEVGMLIGGVWLKGWIQAAAAMSNLGLFEAEMSSDAFQLLGMSEMGMLP
AFFAQRSKYGTPTISILCSATGVIFLSWMSFQEIIEFLNFLYALGMLLEFAAFVKLRIKKPDLNRPYRVPLNTFGTLMLC
LPPSLLLILVMVLATVKTFFVSGVIIVVGFCLHPFLKLVKEKRWARFIPEETRPVLEVPSESQLDEEHGDESSASLLP*

DNA
ATGGGTGAAGAGATAATCGCAAACGATGACAACAGCTCAAAGACGAAACCAAGTCCAAAGCTAACACTCTTGCCTCTTGT
ATTCCTCATCTTCTATGAAGTCTCTGGCGGCCCTTTTGGTGTGGAAGACTCTGTCAAATCAGGTGGTGGTCCTCTCTTAG
CCCTTCTAGGCTTCCTTATCTTCCCTCTGATCTGGAGCATACCCGAAGCTCTCGTCACAGCCGAGCTCGCCACAAGCTTC
CCTGAGAACGGTGGCTACGTGGTCTGGATCTCTTCAGCGTTTGGCCCCTTCTGGGGGTTACAGGAAGGGTTCTGGAAGTG
GTTCAGTGGCGTCATGGACAATGCTCTCTACCCTGTGCTGTTTCTTGATTACTTGAAACATTCTTTCCCTGTTTTGGACC
ATGCAGCTGCTCGTGTTCCTGCTCTGTTAGCCCTCACGTTCGCGCTGACCTACTTGAACTACAGAGGGTTGCATATCGTT
GGCTTCTCAGCTGTTCTGCTAGCTGTCTTCTCCCTCTGCCCTTTCGTTGTGATGGCTTTGCTAGCGGTTCCTAGGATCAG
TCCTAAGCGTTGGCTGTTTGTGGATTTCAAGAAGGTTAACTGGAGAGGGTACTTCAACACCATGTTTTGGAATCTCAACT
ACTGGGACAAGGCTAGTACTCTTGCTGGGGAAGTTGAGTCCCCCGGGAAGACGTTTCCGAAGGCTTTGTTTGGAGCTGTT
TTGTTGGTTATGGGATCTTATTTGATTCCCTTGATGGCGGGGACTGGAGCTTTAAGCGAGTCTGCTTCAGGTGAGTGGAG
TGATGGGTATTTTGCTGAGGTTGGGATGCTTATTGGTGGTGTTTGGCTCAAGGGATGGATACAAGCTGCTGCTGCTATGT
CGAATCTTGGTTTGTTTGAAGCTGAGATGAGTAGTGATGCTTTTCAGCTTCTTGGTATGAGTGAGATGGGGATGCTCCCT
GCTTTTTTCGCCCAGAGGTCAAAGTATGGGACACCAACGATTAGTATCTTGTGCTCAGCGACAGGAGTCATATTCTTGTC
ATGGATGAGCTTTCAAGAGATCATTGAATTTCTGAATTTCTTATACGCGTTAGGAATGCTTCTTGAATTCGCAGCCTTTG
TGAAGCTAAGGATCAAGAAACCGGATCTTAACCGACCTTACAGAGTTCCCTTGAACACCTTTGGAACTTTGATGCTATGT
CTGCCTCCTTCTTTGCTTCTCATCCTTGTGATGGTTTTGGCCACCGTGAAGACGTTTTTTGTCAGCGGTGTGATTATTGT
TGTTGGGTTCTGCTTGCACCCGTTCTTGAAACTCGTGAAGGAGAAACGATGGGCGAGATTCATACCAGAGGAAACAAGAC
CAGTTTTAGAAGTTCCATCCGAGTCTCAGTTGGATGAAGAACATGGTGATGAGTCTTCTGCTAGCCTTCTCCCATGA