Details for Chinese cabbage Locus Brara.A02871

Position : A01 ( 5`- 24385118 .. 24388526 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02871

Protein [Map View]
MVPAIPQAATSTRKPPPDPQDKPLPSNNQRRRPTLKNVPSRYLSPSPSHSHSHSTSSITSSSSALLKTSKRYPSPLLSRA
TPPASNRINAPSSLPNRSQSVDRRRPSQTPVAEMSVAAKMLITSTRSLSVSFQGEVFSLPISKKKEITTTTTTPVSHRKP
TPERRRSPQVRDQRENSKPVDHQQQQLWPGASTRGSSKSAVSSVSKNVDCECDDRGKKLGSMLQQSSRVSIDGRLGLDLG
EGDGVLELRDERKTRFTSTSDFTASDSDSVSSGSTNGAQERGERRSSQRNVIASAKFWQETNTRLRRFQDPSSPRCSSPS
SRISSISSKLSQSKRFAGDGPLVSSPRGMASPIRGGATRPASPIKVKATATSSTARALSSPCRVRNGVSEQMNAYNRNLP
SILCFTADIRRGKIGEDRVMDAHLLRLLYNRHLQWRFANARADSTFMVQRLSAEKNLWNAWVSISDLRHSVTLKRIRLLL
LKQKLKLASILKEQMGYLEEWSLLDRDHSNSLLGATEALKASTLRLPIIGKAVVDILDLKHAVSSAVDVMHAMASSIFSL
TSKVDGMNSVMAEMVNITAQETVLLEQCQGFLSIVAAMQVKDCSLKTHIIQLSRKLTSQL*

DNA
ATGGTCCCTGCGATTCCTCAAGCAGCAACCTCCACCAGGAAACCACCTCCAGATCCGCAAGACAAACCTCTCCCCAGCAA
CAATCAACGAAGAAGACCTACACTCAAAAATGTACCCTCTCGCTACTTATCCCCTTCTCCTTCCCATTCTCACTCTCACT
CCACCTCCTCTATCACATCTTCGTCGTCTGCATTACTCAAGACAAGTAAGCGGTATCCTTCCCCTTTGCTCTCTCGCGCC
ACTCCTCCCGCTTCTAATCGGATCAACGCGCCTTCCTCGCTACCCAATCGGTCTCAATCGGTAGACCGTCGCCGGCCGTC
GCAGACTCCTGTCGCTGAAATGTCGGTGGCGGCGAAGATGCTCATCACTTCCACCAGGAGCTTATCTGTTTCCTTCCAAG
GAGAGGTGTTTTCACTTCCGATTAGCAAGAAGAAGGAGATTACTACTACTACCACCACGCCGGTTTCCCACCGGAAACCT
ACCCCCGAGCGGCGGAGGTCGCCGCAGGTTCGAGATCAGAGGGAGAACTCAAAGCCGGTTGACCACCAGCAGCAGCAGCT
CTGGCCAGGCGCTTCCACGAGAGGAAGTTCTAAATCTGCGGTGAGTTCAGTTTCTAAAAATGTGGATTGTGAGTGTGATG
ATAGAGGGAAGAAGCTTGGATCAATGTTGCAGCAGAGCTCTAGGGTTTCTATTGATGGGAGATTAGGTTTAGATTTGGGA
GAAGGTGATGGAGTTTTGGAATTGAGAGATGAGAGAAAGACAAGATTCACAAGCACTAGTGACTTTACTGCGTCTGATTC
TGATAGTGTTTCTTCTGGTAGCACTAATGGTGCGCAGGAACGTGGTGAAAGAAGGAGCTCGCAACGTAACGTTATAGCTT
CTGCTAAGTTCTGGCAAGAGACTAACACTCGGTTAAGGAGGTTTCAGGATCCTAGCTCACCTCGGTGCTCTAGCCCGAGT
TCGAGGATAAGTAGTATCTCATCAAAGTTGAGTCAGTCTAAACGGTTCGCTGGTGATGGTCCGTTGGTGTCATCTCCTCG
TGGTATGGCTTCTCCGATACGAGGTGGTGCTACTCGACCTGCTTCACCTATTAAGGTTAAGGCGACAGCTACTTCATCTA
CTGCTAGAGCACTTTCTAGTCCTTGTCGAGTGAGAAATGGAGTTTCTGAGCAAATGAACGCTTATAACCGCAACTTGCCT
TCGATTCTTTGTTTCACTGCTGATATTAGGAGGGGGAAGATCGGGGAGGATCGGGTTATGGATGCCCACTTGTTGAGGCT
TCTGTATAACCGTCATTTGCAGTGGCGGTTTGCCAATGCCAGGGCTGACTCCACTTTCATGGTGCAGAGACTGAGTGCAG
AGAAAAACCTGTGGAATGCATGGGTATCAATCTCGGACTTGCGCCATTCTGTCACTCTGAAACGGATCAGGTTGCTCTTG
CTGAAGCAGAAATTGAAACTAGCTTCCATCTTGAAGGAGCAGATGGGTTACCTAGAAGAATGGTCTCTTCTAGACAGAGA
TCATTCGAATTCTTTGTTAGGAGCAACTGAAGCCTTGAAAGCCAGCACGCTTCGTCTTCCAATTATTGGAAAAGCTGTGG
TTGATATTCTAGATCTTAAGCATGCTGTTAGTTCAGCTGTTGATGTGATGCATGCTATGGCGTCTTCCATATTCTCGCTG
ACATCGAAGGTGGATGGAATGAATTCAGTAATGGCGGAGATGGTGAATATCACTGCACAAGAAACGGTCTTGCTCGAACA
ATGTCAAGGATTCTTATCAATAGTAGCAGCGATGCAGGTTAAAGACTGTAGCTTGAAGACGCACATAATACAACTAAGCC
GGAAACTGACTTCACAACTGTAG