Details for Chinese cabbage Locus Brara.A02870

Position : A01 ( 5`- 24382669 .. 24383885 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02870

Protein [Map View]
MALEAMNSPSFTVRKDRIAATEDDLTNDAVFMEPWLKRKRSKRQRSRSPSPSTSSSSPPRSRLPKSESQDLTEEEYLALC
LLKLAKDKHSPPPQPQPRDSTKLSYKCSVCGKAFPSYQALGGHKASHRIKPLTADNSTSPIIAGEKHHSSATVPPSGKIH
ECSICRKVFPTGQALGGHKRCHYEGNLGGGSKSISQSGSVSSTVSEDRSNRVLIDLNLPALPELSLHHNPVVDDEILSPL
TGKKPLLLTDRDQVIKKEDLSLRI*

DNA
ATGGCTCTCGAAGCGATGAATTCTCCTTCGTTCACAGTCCGTAAAGATAGAATCGCAGCAACAGAAGATGATCTAACGAA
CGACGCCGTTTTCATGGAGCCTTGGCTGAAACGCAAACGCTCGAAACGCCAGCGTTCTCGCAGCCCTTCTCCGTCCACCT
CTTCCTCCTCGCCGCCTCGATCTCGCCTCCCTAAATCCGAGAGTCAGGATCTCACGGAGGAAGAGTATCTCGCTCTCTGT
CTCCTCAAGCTCGCTAAAGACAAACACTCGCCGCCGCCGCAGCCGCAGCCGCGAGACTCGACGAAGCTCTCGTACAAGTG
TAGCGTTTGCGGAAAAGCGTTTCCTTCGTATCAGGCGTTAGGCGGACACAAAGCGAGCCACCGAATCAAGCCTCTAACCG
CCGATAATTCGACGTCTCCGATCATCGCCGGAGAGAAGCATCACAGTTCCGCCACCGTCCCGCCTTCCGGGAAGATTCAC
GAGTGCTCTATCTGCCGTAAAGTGTTTCCGACGGGTCAAGCACTCGGCGGTCACAAACGGTGCCACTACGAAGGAAACCT
CGGAGGAGGAAGCAAATCGATTAGCCAGAGTGGAAGCGTGTCGAGCACGGTTTCGGAAGATCGAAGCAACCGCGTGTTGA
TCGATCTGAACCTCCCGGCTTTACCGGAGCTCAGCCTTCATCACAACCCAGTCGTCGACGATGAGATACTGAGTCCGTTG
ACCGGGAAGAAACCGCTTTTGTTGACCGATCGTGACCAAGTCATCAAGAAAGAAGATTTATCTCTAAGAATATAA