Details for Chinese cabbage Locus Brara.A02869

Position : A01 ( 5`- 24375626 .. 24378365 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02869

Protein [Map View]
MSQPPPSAGRELANPPSDGISNLRFSNTSDHLLVSSWDKRVRLYDVSTNSLKGEFLHGGAVLDCCFHDDSSGFSVGSDNK
VRRIVFNVGKEDVLGMHEKPVRCVEYSYAAGQVITGSWDKTVKCWDPRGASGPERTQVGTYLQPERVYSLSLVGNRLVVA
TAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRSYPNGTGYALSSVEGRVAMEFFDLSEAAQAKKYAFKCHRKSEAGRDI
VYPVNAIAFHPIYGTFATGGCDGFVNIWDGNNKKRLYQYSKYPSSIAALSFSRDGQLLAVASSYTFEEGEKSHEPEAIFV
RNVNEIEVKPKPKAYPNPAA*

DNA
ATGAGTCAGCCTCCTCCGTCCGCCGGTCGTGAGCTCGCGAATCCACCGTCCGACGGCATCTCCAATCTCAGGTTTTCCAA
CACGAGTGACCATCTCCTCGTTTCTTCATGGGATAAGCGTGTGAGATTGTACGATGTGAGCACCAATTCGTTGAAAGGAG
AGTTCTTACACGGCGGCGCTGTTCTCGATTGCTGTTTCCACGACGATTCCTCTGGTTTCAGCGTTGGCAGCGACAACAAA
GTCAGACGGATTGTTTTCAATGTTGGCAAAGAGGATGTTCTGGGGATGCATGAAAAGCCTGTGCGTTGTGTTGAGTATTC
TTATGCTGCAGGGCAAGTGATTACGGGATCATGGGACAAAACAGTTAAGTGTTGGGATCCAAGAGGTGCAAGTGGGCCGG
AGCGCACCCAGGTGGGGACATACTTGCAACCAGAGCGTGTTTACTCTCTGTCTCTTGTTGGAAACCGTCTCGTTGTGGCA
ACAGCAGGAAGGCACGTCAACATCTACGATCTCAGGAATATGTCTCAGCCTGAGCAAAGAAGGGAGTCTTCACTCAAATA
CCAGACCAGATGTGTTCGTAGTTATCCTAATGGAACAGGTTATGCTCTTAGCTCTGTTGAAGGAAGAGTTGCGATGGAGT
TCTTTGATCTGTCAGAGGCTGCTCAGGCTAAGAAATATGCTTTCAAATGCCATCGGAAATCAGAGGCTGGAAGAGACATT
GTTTACCCTGTGAATGCCATTGCTTTCCATCCAATTTATGGCACATTTGCAACGGGAGGCTGTGATGGTTTTGTCAACAT
ATGGGATGGGAACAACAAGAAGAGGCTGTATCAGTACTCAAAATATCCATCAAGCATCGCAGCACTGTCATTCAGCCGAG
ATGGTCAGCTACTAGCTGTTGCATCAAGCTACACATTTGAAGAGGGAGAGAAATCGCACGAGCCAGAAGCCATCTTTGTA
AGAAACGTCAATGAAATCGAAGTGAAACCCAAACCCAAGGCATATCCAAATCCTGCGGCATAG