Details for Chinese cabbage Locus Brara.A02867

Position : A01 ( 5`- 24372507 .. 24372928 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02867

Protein [Map View]
MEGLIPYLIHAIKKDHKPQDQGYRSLSVGSSRGYRPLMMGQEGSSSLQGSSHRRTKSEYKPPVMMDMFDQTSSGGFGQNS
VNEDLSSQNIATKLQHADRR*

DNA
ATGGAGGGGTTGATTCCATATCTGATTCATGCTATCAAGAAAGACCATAAGCCACAAGATCAGGGGTATCGATCGTTGTC
TGTAGGATCTAGCCGAGGCTACCGACCATTAATGATGGGACAGGAAGGTTCTTCTTCATTACAGGGATCTTCTCACCGTC
GAACAAAATCAGAGTACAAGCCACCTGTGATGATGGATATGTTTGATCAGACATCATCAGGAGGTTTTGGTCAAAACTCT
GTGAATGAAGATCTTTCTTCTCAGAATATAGCAACCAAGCTTCAGCATGCAGATAGACGTTGA