Details for Chinese cabbage Locus Brara.A02866

Position : A01 ( 5`- 24367760 .. 24370188 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02866

Protein [Map View]
MRGPRPEDFDTNAGHPTPTFPAGGSRKKGMGVRTWLVLCSSGKEQATEAGKHTIMRRTGLPARDLRILDPLLSYPSTVLG
RERAIVINLEHIKAIITGQEVLILNSKDPSVAPFIEELQRRIRCHHHATKPQEGVNTEGAAQGEAGTSQLSGEEARKDKK
QSLGNQDGSKVLPFEFVALEACLEAAITSLESEAVRLELEAHPALDKLTIKINTLNLERVRQIKSRLVAITGRVQKVRDE
LEKLLNDDEDMAEMYLTDKLAQKQLENSTASSTSDTVVVDLPEGDEDDRHVADYFEHATLVSSESCHRGSDAHNLLMRAH
SALSRNSRGTSSTRSGMTNKLNVQELEMLLEAYFVQIDGILNKLSTLTEYVDDTEDYINIMLDDKQNNLLQMGVMLTTAG
LVMSLFIAVAGVFGMNINIELFNDEVAGPGKFMWTVVGGTAGSLFLYFGAIGWYKHSRLLE*

DNA
ATGAGAGGCCCTAGACCCGAAGATTTCGACACCAACGCCGGCCACCCGACGCCTACCTTCCCCGCCGGTGGTAGCCGGAA
GAAAGGCATGGGCGTGAGGACGTGGCTGGTGCTTTGCTCGTCGGGGAAGGAGCAAGCGACGGAGGCCGGGAAACACACCA
TCATGCGTCGAACTGGCTTACCGGCGCGTGATCTCCGGATCCTCGATCCGTTGTTGTCGTATCCGTCTACCGTTCTAGGT
CGCGAGAGAGCCATCGTCATCAATCTGGAGCATATCAAGGCGATCATCACGGGGCAAGAGGTTTTGATTCTGAATTCGAA
GGATCCTTCGGTGGCTCCGTTCATCGAGGAGTTGCAGAGGAGGATTAGGTGTCACCATCACGCCACTAAACCTCAGGAGG
GAGTGAACACTGAGGGAGCCGCACAAGGAGAAGCTGGAACGTCACAATTGTCTGGGGAGGAAGCCAGGAAGGATAAGAAG
CAAAGTCTTGGGAATCAAGATGGATCCAAGGTTCTTCCTTTTGAGTTTGTTGCTCTTGAAGCTTGTCTTGAAGCTGCCAT
CACCAGTTTGGAAAGTGAGGCCGTTAGATTGGAGTTAGAGGCTCATCCAGCGTTGGACAAGCTTACTATCAAGATCAATA
CCCTCAACTTGGAGCGGGTTCGACAGATTAAGAGTAGGCTTGTTGCAATAACTGGGCGTGTTCAGAAGGTTAGGGACGAA
CTAGAAAAACTCCTAAACGATGATGAAGATATGGCTGAGATGTATCTTACAGATAAGTTAGCTCAGAAGCAGCTTGAGAA
TTCGACGGCTTCCTCTACTAGTGATACCGTCGTGGTTGATCTTCCTGAAGGAGACGAGGATGACAGGCATGTAGCAGACT
ATTTTGAACATGCTACCTTAGTTTCATCTGAAAGCTGCCATCGAGGAAGTGACGCTCACAACCTTCTAATGAGAGCTCAT
AGCGCACTTAGCAGAAACAGCCGTGGGACGAGCTCAACCCGGAGTGGCATGACCAACAAACTCAATGTGCAAGAGCTTGA
AATGCTTTTGGAAGCATATTTCGTGCAAATTGATGGTATACTGAACAAACTATCAACACTAACGGAATACGTGGATGACA
CGGAGGACTACATCAACATAATGCTAGATGACAAACAGAATAATCTTCTGCAGATGGGGGTGATGCTAACAACGGCAGGA
CTGGTGATGAGTCTCTTTATCGCGGTTGCGGGAGTATTCGGGATGAACATTAACATAGAGCTGTTCAATGATGAAGTAGC
TGGTCCGGGGAAATTCATGTGGACAGTGGTTGGAGGTACGGCAGGAAGTTTATTCCTCTATTTTGGTGCCATCGGATGGT
ATAAGCATAGTCGTTTGCTTGAATGA