Details for Chinese cabbage Locus Brara.A02865

Position : A01 ( 5`- 24364064 .. 24364264 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02865

Protein [Map View]
MLGLQLESLVETLKSKVGLLRRKKRKPYIKMDKSSSVRVEIRRKKTRDLINKTLKIADRPGQRALS*

DNA
ATGCTGGGACTACAGTTGGAGAGCTTGGTGGAGACTCTAAAGTCAAAGGTGGGTTTGTTGAGGAGGAAGAAAAGGAAACC
TTACATCAAAATGGATAAAAGCAGCAGCGTCAGGGTTGAGATACGTCGTAAGAAGACCAGAGATCTCATCAATAAGACCT
TGAAGATCGCTGATCGTCCTGGCCAACGAGCTCTTTCCTGA