Details for Chinese cabbage Locus Brara.A02855

Position : A01 ( 5`- 24301377 .. 24308474 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02855

Protein [Map View]
MYTRAIKRNQRLGLVLQQAKYLVRPAIRDYTVSRSYGLTNHLTSNANLTRGSLFRSFSSHGGGTSIACRSSLRLSKNIQL
RSFSSEGDDKHVSLNKGSDIGDGKTGKEKTSCGVGHLDSHAQLGEQDQIEWLSNEKLASECKKKESPLLSRRERFKNEFL
RRVQPWEKIQLSWETFPYYIHDHTKNILVECVTSHIRQRNATSMYGARLDSSSGRILLQGLPGTDLYQERLVRALARDVQ
VPLLVLDSSVLAPYDFSDEYNEDSESDGENAEAEADEGTTESEAEEDSGANSEEDSEAKTDGSDNEETRLEVTEEDIKKI
VPKLEELGELVAEELHEAGGACEAAAVEHSDKARRPARKGDRVKYVGTSKKGDAKHRPLTTGQRGEIFEVNGNRVAVVFD
NEGDTSSEGSEKKPKKQSQKPNIHWIDVKDLKHDLDMQAEDGYTALKALNEVLQSTQPLIVYFPDSSRWLSRAVPKAKRN
EFVDKVEEMFDKVTGPVVLICGRNKIETASKGREKFTMILPNFGRIAKLPLPLKHLTEGLSGRKSSDDNEIYKLFTNVMN
LLPPKEEDVLAVFNKQLVEDRRIVVSRSNLNEILKALEENELLCTDLYQVNTDDVILTKQRAEKVVGWARNHYLSSCSKP
LIKEDRLILPRESIEISVKRLKAQEDISRKPSHSLKNIAKDEFESNFVSAVVAPEEIGVKFDDVGALEHVKKTLNELVIL
PMRRPELFTRGNLLRPCKGILLFGPPGTGKTLLAKALATEAGANFISITGSSLTSKWFGDAEKLTKALFSFASKLAPVII
FVDEVDSLLGARGGSHEHEATRRMRNEFMAAWDGLRSKDSQRILILGATNRPFDLDDAVIRRLPRRIYVDLPDADNRLKI
LKIFLTPENLETGFEFEKLAKETEGYSGSDLKNLCIAAAYRPVQELLQEENKGSGANGVAPDLRPLSLDDFIQSKTKVSP
SVSYDATTMNELRKWNEQYGEGGSRTKSPFGF*

DNA
ATGTATACTAGAGCAATAAAAAGGAACCAGAGATTGGGTTTGGTATTGCAGCAAGCCAAATACTTAGTTAGACCAGCCAT
TCGTGACTACACTGTGTCCAGATCTTATGGACTCACTAATCATTTGACCAGTAATGCAAATCTGACAAGAGGGTCTCTCT
TCCGTTCGTTTTCTTCCCACGGTGGTGGTACTAGTATTGCCTGCAGAAGTAGTTTAAGACTCTCGAAGAACATCCAGCTT
CGTAGTTTTAGTTCTGAAGGTGATGATAAACATGTCTCTTTGAACAAAGGGAGTGACATTGGTGATGGAAAAACCGGGAA
GGAGAAAACTAGTTGCGGTGTGGGGCATTTAGATTCGCATGCTCAACTAGGGGAACAGGACCAAATAGAATGGCTCAGTA
ACGAGAAGCTTGCTAGTGAATGCAAAAAGAAGGAGTCACCTCTTCTTTCTAGACGAGAAAGATTCAAAAACGAGTTTTTG
AGGAGAGTCCAACCTTGGGAGAAGATACAGCTTTCGTGGGAGACCTTCCCTTACTATATCCACGACCACACCAAAAACAT
TTTGGTGGAATGTGTTACCTCACATATAAGACAAAGGAATGCCACTTCAATGTATGGTGCCCGTTTAGATTCTTCAAGTG
GAAGAATATTGCTCCAGGGCCTTCCAGGGACTGACCTTTACCAGGAGAGGCTGGTGCGAGCACTTGCTCGAGATGTACAA
GTTCCCCTGTTGGTTCTTGACAGCAGCGTTCTTGCCCCTTATGATTTTTCTGATGAGTACAATGAAGACTCTGAATCTGA
TGGTGAGAACGCAGAAGCGGAAGCAGATGAAGGCACAACGGAGTCTGAAGCTGAGGAAGATTCTGGAGCGAATAGTGAGG
AGGATTCTGAAGCGAAAACAGATGGGAGTGACAATGAGGAAACTCGTCTTGAGGTTACTGAGGAAGATATCAAGAAAATT
GTGCCAAAACTTGAGGAGCTCGGAGAGTTAGTAGCGGAAGAACTACATGAAGCTGGTGGAGCTTGCGAAGCGGCAGCTGT
TGAGCATTCTGATAAAGCTAGGCGCCCGGCAAGGAAAGGAGATCGAGTCAAATATGTTGGAACTTCTAAGAAGGGTGATG
CAAAGCACAGGCCATTAACTACTGGACAGCGTGGAGAGATCTTCGAGGTGAATGGGAACCGAGTTGCGGTCGTATTTGAC
AATGAAGGTGATACATCATCAGAGGGAAGCGAGAAGAAACCAAAAAAGCAGTCCCAGAAGCCCAATATACACTGGATAGA
TGTTAAAGACCTGAAGCATGATTTGGATATGCAGGCAGAAGATGGCTACACTGCCCTGAAGGCTTTAAATGAGGTTTTGC
AATCAACACAACCACTTATTGTCTATTTTCCAGACTCGTCCCGGTGGTTGTCTAGAGCTGTGCCCAAGGCAAAACGAAAT
GAGTTTGTAGACAAAGTTGAGGAAATGTTTGATAAAGTGACAGGTCCTGTTGTACTGATCTGCGGACGGAACAAGATTGA
GACAGCCTCCAAAGGGAGAGAGAAATTCACGATGATACTCCCAAACTTTGGCCGCATTGCGAAACTGCCCCTTCCTTTGA
AGCATCTTACTGAGGGGCTCAGCGGAAGGAAAAGTTCAGATGATAATGAGATATACAAATTATTCACTAATGTTATGAAC
CTACTTCCTCCTAAGGAGGAAGATGTCCTTGCAGTATTCAACAAACAACTTGTAGAAGATAGAAGAATTGTTGTATCACG
GAGCAATTTAAATGAGATACTTAAGGCCCTTGAGGAAAACGAGTTATTATGCACAGACTTGTACCAAGTGAACACCGATG
ACGTCATATTGACAAAACAAAGGGCAGAGAAAGTTGTTGGCTGGGCCAGAAACCACTATTTATCTTCTTGTTCGAAACCG
TTGATTAAAGAAGACCGCCTGATTCTGCCTCGTGAAAGCATTGAGATATCAGTTAAGAGGTTGAAAGCACAAGAAGATAT
ATCTCGAAAGCCTTCACATAGCTTGAAGAACATAGCAAAGGATGAGTTCGAAAGCAATTTTGTATCGGCTGTAGTTGCTC
CTGAAGAAATCGGTGTCAAGTTTGACGACGTTGGTGCCCTCGAGCATGTGAAGAAGACACTGAACGAGTTGGTTATTCTT
CCCATGAGAAGGCCAGAGCTCTTCACTCGTGGCAATCTCTTGCGGCCGTGTAAAGGCATATTGCTTTTTGGCCCTCCTGG
TACTGGTAAAACGCTACTTGCCAAGGCCCTTGCTACAGAAGCTGGAGCTAACTTCATTAGCATAACTGGCTCATCGCTTA
CATCAAAGTGGTTTGGAGATGCAGAGAAGCTCACGAAAGCTCTCTTCTCCTTTGCGAGCAAGCTTGCGCCTGTGATTATT
TTTGTCGATGAGGTTGACAGTCTATTGGGAGCTCGTGGTGGTTCTCACGAGCATGAGGCAACGCGAAGAATGAGAAACGA
GTTCATGGCAGCATGGGATGGGCTGAGGTCAAAAGATAGCCAAAGGATACTCATACTCGGTGCCACCAACCGACCTTTTG
ATCTTGATGACGCTGTCATTCGCCGTCTACCAAGAAGGATATATGTGGATTTACCAGATGCTGATAACCGGTTAAAGATA
TTGAAGATATTTCTGACTCCAGAAAATCTTGAAACCGGTTTCGAGTTTGAGAAACTTGCAAAAGAAACCGAAGGATACTC
AGGAAGCGATCTAAAGAATCTATGCATCGCTGCTGCGTACAGACCAGTTCAAGAATTATTACAGGAAGAAAACAAGGGTT
CGGGAGCAAATGGTGTAGCTCCTGATCTACGGCCTCTGAGTTTGGACGACTTCATCCAATCTAAAACTAAGGTAAGTCCG
TCTGTGTCATATGATGCAACGACGATGAACGAGCTGAGAAAATGGAACGAGCAGTACGGTGAAGGTGGTAGCCGGACCAA
GTCTCCGTTCGGCTTTTAA