Details for Chinese cabbage Locus Brara.A02854

Position : A01 ( 5`- 24298614 .. 24301245 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02854

Protein [Map View]
MAEANPGRGGGRRGGGPMDDDKLVFETTEGIEPITNFNDMGIKEDVLRGVYEYGFEKPSAIQQRAVMPILQGRDVIAQAQ
SGTGKTSMIALSVCQIVDTSSREVQALILSPTRELASQTEKTIQAIGLHANIQAHACIGGKSVGEDIRKLENGVHVVSGT
PGRVCDMIKRRSLRTRGIKLLILDESDEMLSRGFKDQIYDVYRYLPPDLQVCLVSATLPHEILEMTSKFMTEPVKILVKR
DELTLEGIKQFFVAVEKEEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLSEKMRTNNFTVSSMHGDMPQKERDEIMNQF
RSGDSRVLITTDVWARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKSDDIKILRDIEQYYSTQIDEM
PMNVADLI*

DNA
ATGGCGGAAGCGAATCCTGGCCGTGGAGGAGGAAGGAGAGGCGGCGGACCAATGGACGACGACAAATTAGTCTTCGAAAC
AACCGAAGGGATCGAGCCCATCACCAATTTCAACGACATGGGGATCAAGGAAGACGTACTCCGCGGCGTCTACGAGTACG
GCTTCGAGAAGCCCTCCGCGATTCAGCAGAGAGCGGTCATGCCTATTCTCCAGGGCCGCGATGTAATCGCCCAGGCTCAG
TCCGGTACCGGAAAAACCTCCATGATTGCTCTCTCCGTCTGCCAAATCGTTGACACTTCCTCTAGAGAAGTTCAGGCGTT
GATATTGTCTCCGACGAGGGAGCTGGCTTCGCAGACGGAGAAGACTATTCAAGCTATTGGGTTGCACGCTAATATTCAGG
CGCACGCGTGTATTGGTGGGAAGAGCGTTGGTGAGGATATTAGAAAGCTGGAGAATGGTGTTCATGTTGTGTCTGGGACG
CCTGGGCGTGTATGTGATATGATTAAGAGGAGGAGTCTGCGTACCAGGGGTATTAAGCTTTTGATTCTTGATGAATCTGA
TGAGATGCTGAGCAGAGGGTTCAAGGATCAGATATATGATGTTTACAGATATCTTCCACCTGATCTTCAGGTTTGCTTGG
TTTCTGCAACTCTTCCTCACGAGATTTTGGAGATGACATCGAAGTTTATGACGGAGCCAGTGAAGATACTTGTGAAGCGT
GATGAGTTGACTCTTGAAGGCATTAAACAATTTTTTGTTGCTGTTGAGAAGGAGGAATGGAAGTTTGATACACTCTGTGA
TCTTTATGACACGCTTACTATCACTCAAGCTGTTATCTTCTGCAACACTAAACGAAAGGTGGATTGGCTAAGTGAGAAAA
TGAGGACTAACAACTTCACAGTCTCATCAATGCACGGTGACATGCCTCAGAAGGAAAGAGACGAAATCATGAATCAGTTC
CGGTCAGGCGACAGTCGTGTATTGATCACGACAGATGTATGGGCACGTGGGATTGATGTGCAGCAAGTTTCTCTCGTCAT
CAATTATGATCTCCCCAACAACCGTGAGCTCTACATCCATCGTATTGGACGATCTGGTCGTTTCGGGCGCAAGGGTGTTG
CGATCAACTTTGTTAAAAGCGATGACATCAAGATCCTCAGGGACATTGAGCAGTACTACAGTACCCAGATTGACGAGATG
CCAATGAATGTAGCTGATCTTATCTAA