Details for Chinese cabbage Locus Brara.A02852

Position : A01 ( 5`- 24292233 .. 24294990 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02852

Protein [Map View]
MADLKAPLVRPKRKKTWVDYFVKFRWIIVIFVVLPISATLYFLIYLGDMYSESKSYEQRRKEHDKNVLKVIKRLKQRNAS
KDGLVCTARKPWIAVGMRNVDYKRARHFEVDLGEFRNILEINKEKMIARVEPLVNMGQISRATVPMNLSLAVVAELDDLT
VGGLINGYGIEGSSHLYGLFADTVEAYEIVLAGGELVRATRDNEYSDLFYAIPWSQGTLGLLVAAEIRLIPVKEYMRLTY
IPVKGDLQALAQGYMDSFAPKDGDESKIPDFVEGMVYNPTEGVMMVGTYASKAEAKKKGNQINNVGWWFKPWFYQHAQTA
LKKGQFVEYIPTREYYHRHTRCLYWEGKLILPFGDQFWFRFLFGWLMPPKVSLLKATQGEAIRNYYHDMHVIQDMLVPLY
KVGDALEWVHNEMEVYPIWLCPHKLYKAPIKQQIYPEPGFEYEKRQGDTDDAQMYTDVGVYYAPGPVLRGEEFDGSEAVR
KMEKWLIENHGFQPQYAVSELDEKSFWRMFDGDLYEHCRKKYRAVGTFMSVYYKSKKGRKTEKEVREAEQAHLETAYAEA
D*

DNA
ATGGCGGATCTTAAGGCACCGCTTGTGAGGCCAAAGAGAAAGAAGACATGGGTCGACTACTTCGTCAAGTTCAGATGGAT
CATCGTCATATTCGTCGTCCTCCCAATCTCAGCCACACTCTACTTCCTCATCTACCTCGGCGACATGTACTCAGAGTCCA
AATCCTACGAGCAGCGCCGCAAGGAACACGACAAGAACGTCCTGAAAGTCATCAAACGCCTCAAGCAGAGGAACGCATCC
AAGGACGGTCTTGTCTGCACCGCACGCAAGCCCTGGATCGCCGTGGGGATGAGGAACGTCGACTACAAGAGAGCTCGCCA
CTTCGAGGTCGACCTGGGAGAGTTCCGCAACATCCTAGAGATCAACAAGGAGAAGATGATCGCTAGAGTCGAGCCTCTTG
TCAACATGGGACAGATCTCTCGCGCCACCGTCCCCATGAACCTCTCTCTAGCTGTCGTCGCTGAGCTGGATGATCTCACC
GTTGGTGGACTCATTAACGGATACGGTATCGAAGGGAGCTCTCACCTCTACGGTCTCTTTGCGGACACCGTCGAGGCTTA
CGAGATTGTCCTAGCTGGTGGGGAGCTTGTACGTGCCACTAGAGATAATGAGTATTCAGATCTTTTCTACGCGATCCCTT
GGTCGCAAGGCACTCTTGGACTCCTTGTTGCTGCTGAGATTAGGCTTATACCGGTTAAGGAGTACATGAGGCTCACTTAC
ATACCGGTCAAGGGAGATCTTCAGGCCTTAGCACAAGGCTATATGGACTCTTTCGCGCCCAAAGATGGAGACGAGTCAAA
GATCCCTGACTTCGTCGAAGGCATGGTTTACAATCCGACAGAAGGTGTGATGATGGTTGGGACATACGCGTCTAAGGCAG
AAGCCAAGAAGAAAGGGAACCAGATCAACAATGTGGGATGGTGGTTCAAGCCGTGGTTCTACCAACATGCTCAGACCGCG
TTGAAGAAGGGACAGTTTGTTGAGTACATCCCAACGCGTGAGTACTACCATAGGCACACGAGGTGTTTGTACTGGGAAGG
GAAGCTTATCCTTCCTTTTGGTGACCAGTTTTGGTTTAGGTTCCTCTTTGGTTGGTTGATGCCTCCAAAGGTGTCTCTTC
TCAAGGCTACTCAAGGTGAAGCTATTAGGAACTACTACCATGATATGCATGTTATTCAGGACATGCTTGTTCCTCTTTAC
AAGGTCGGTGATGCTCTTGAATGGGTCCACAACGAAATGGAGGTGTATCCCATTTGGCTTTGCCCACACAAACTCTACAA
GGCACCAATCAAACAACAGATTTACCCTGAACCAGGGTTTGAGTATGAGAAGAGACAAGGAGACACGGATGATGCTCAGA
TGTACACTGACGTTGGAGTCTACTACGCACCAGGTCCTGTCCTAAGAGGTGAAGAGTTTGATGGTTCAGAAGCTGTGCGT
AAGATGGAGAAGTGGCTGATTGAGAACCATGGGTTCCAGCCTCAGTATGCAGTCTCTGAGCTTGATGAGAAGAGTTTCTG
GAGGATGTTTGATGGTGACTTGTACGAGCATTGCCGCAAGAAGTACAGAGCTGTCGGAACGTTCATGAGTGTTTACTACA
AGTCTAAGAAAGGAAGGAAGACTGAGAAAGAAGTAAGAGAAGCAGAGCAAGCTCATCTTGAAACAGCTTATGCTGAGGCA
GATTAA