Details for Chinese cabbage Locus Brara.A02851

Position : A01 ( 5`- 24287457 .. 24289804 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02851

Protein [Map View]
MADQVIRIRRTVKLLLLGLLVRQSGIREQVLQIEVNDCLGFADMAIGTGQVDLGSLPDTVPKDRVVVLRGGWSLFGKGSA
GELLLRLTFKSYVEDEEDEKRNAKANVPYASDDEMSDSEEPSSFVNNDKIPSDDPSQDSCLIIILLIWLLGLKRLSFLIS
GFVLLWFSVITSVLVLVAIDMAGSSFFNP*

DNA
ATGGCTGATCAAGTTATCCGGATAAGAAGAACAGTCAAACTACTATTATTGGGGCTCCTGGTCAGGCAATCTGGAATCAG
AGAGCAAGTATTACAAATTGAAGTCAACGACTGTCTGGGATTCGCTGATATGGCTATTGGTACCGGACAGGTTGACCTTG
GATCACTGCCAGATACGGTTCCTAAAGACAGAGTAGTTGTTTTGCGAGGCGGTTGGAGTTTGTTTGGAAAGGGATCTGCT
GGAGAGTTACTATTGCGGCTTACATTCAAATCGTACGTGGAGGATGAAGAAGATGAGAAACGCAATGCAAAAGCCAATGT
TCCATATGCATCCGATGATGAAATGTCTGATTCCGAAGAACCTAGCTCATTCGTGAATAATGACAAGATTCCTTCTGATG
ATCCTAGTCAAGACTCTTGTCTTATAATTATTTTGCTTATATGGTTGCTTGGTCTAAAACGATTAAGCTTCCTAATTTCA
GGATTTGTGTTATTGTGGTTCAGTGTAATTACTTCTGTGTTGGTGCTCGTTGCTATCGACATGGCCGGCTCAAGTTTCTT
CAACCCGTAA