Details for Chinese cabbage Locus Brara.A02850

Position : A01 ( 5`- 24279969 .. 24282910 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02850

Protein [Map View]
MSLLCDLQINLDHEFTFFVNQDLMSEYSGFLKKTIKQSSKKKKNHKNGRIIIQLQDFPGGPEGFDLVSRFCYSNGGGISI
DVSNVSILYCSSQFLEMTEILCSSNLSLQTEKFLEGMFYWSWNDIVSCLKSCEQVFTHADSYGLVDKLVFGVLAKIAQNS
DMSQVFASSSTSSSASASSMSPETAKNRSDSDKRSTSRSFSCKTSNEWWFDDMSSLGPKIIEKLIKNLGAFDENNDSLVL
TRFLLHYLKTKVHNKSNNKLEYSGLANTAVQGVIFAAKTAFSCRKIFWVLRVLSGFSISKESRTGLERVLGEMLDQAKLD
DLLIPTGGKREKGFYDVDLVVRLLKVFVRNCSSAEEEDESLRIRRMGKLIDEYLREISPDQNLKVSKFLEVAESLPDSAR
DWFDGLFRAIDIYLESHPNLSSEDRTKLCRCLNYKRLTLETCKQLAKNPKIPPNIAVQALKSQQLSNEALPHSREDKIKL
NKTRNSRKYVEEKPILVRLKGFEMSEKLVDGFEDDIRVNLERRHWNKVMDHSEKVCKEKKSELVSRLVRHGHTHTSSNFP
RLC*

DNA
ATGTCTCTTCTCTGTGATCTTCAAATCAATCTCGATCATGAATTCACTTTCTTCGTCAATCAGGATTTGATGTCAGAGTA
CTCAGGGTTCTTGAAGAAGACGATAAAACAGAGTAGCAAGAAGAAGAAGAACCACAAGAACGGTAGAATCATCATCCAAC
TCCAAGACTTTCCAGGCGGACCAGAAGGGTTCGACTTGGTTTCAAGATTCTGTTACAGCAATGGCGGAGGAATCTCTATC
GATGTCTCAAACGTTTCCATCTTGTATTGCTCATCTCAGTTTCTTGAGATGACAGAGATACTCTGTTCCTCAAATCTCTC
TCTTCAAACAGAGAAGTTTCTTGAAGGAATGTTCTACTGGTCATGGAACGACATCGTTTCATGCCTCAAGAGCTGCGAAC
AAGTGTTTACACACGCAGACTCGTACGGTCTTGTGGATAAGCTAGTCTTCGGGGTTTTAGCCAAGATCGCTCAGAACTCG
GACATGAGTCAAGTCTTTGCCTCGTCCTCAACGTCTTCCTCCGCCTCAGCCTCTTCCATGTCGCCGGAGACGGCAAAGAA
TAGGTCTGATTCAGACAAAAGATCCACTTCGAGATCGTTTTCTTGCAAGACAAGCAATGAGTGGTGGTTCGACGATATGT
CAAGTCTCGGGCCAAAGATCATAGAGAAGCTGATAAAGAACCTTGGAGCTTTCGACGAGAACAACGACAGTTTAGTCCTA
ACAAGATTTCTCCTCCATTACCTCAAGACAAAGGTCCACAACAAATCAAATAACAAGCTCGAGTATTCGGGTTTGGCTAA
TACAGCGGTTCAGGGAGTGATTTTTGCTGCGAAAACCGCATTTTCTTGCAGGAAGATCTTCTGGGTTCTTAGAGTTTTAT
CTGGTTTTAGCATCAGCAAGGAATCAAGAACCGGTTTAGAGAGGGTTTTAGGAGAAATGCTGGATCAAGCGAAGCTTGAT
GATCTTCTGATACCGACCGGAGGGAAGAGAGAGAAAGGGTTTTACGATGTTGATTTGGTGGTAAGATTGCTTAAAGTGTT
TGTCAGAAACTGCAGCAGCGCAGAAGAAGAAGATGAGAGTTTGAGGATAAGAAGAATGGGGAAGTTGATTGACGAGTATC
TGAGAGAGATATCACCAGACCAGAATCTTAAAGTGTCAAAGTTTCTAGAAGTTGCAGAGAGTTTGCCAGATTCAGCTAGG
GATTGGTTTGATGGATTGTTCAGAGCCATTGATATCTATCTTGAGTCTCATCCAAATCTATCATCCGAAGATAGAACAAA
ACTATGTCGATGCCTAAACTACAAGAGACTAACATTGGAGACATGCAAACAACTTGCAAAGAATCCCAAGATCCCTCCAA
ATATTGCAGTTCAAGCACTCAAGTCACAACAGTTATCGAACGAAGCTCTACCACACTCGAGAGAAGACAAGATTAAACTA
AACAAGACCAGGAATTCGCGCAAATATGTTGAAGAGAAACCAATACTGGTGCGTCTAAAAGGATTTGAGATGTCAGAGAA
ACTAGTTGATGGGTTTGAAGATGATATAAGGGTAAATTTAGAGAGGAGGCATTGGAATAAAGTGATGGATCATTCTGAAA
AAGTTTGTAAGGAAAAGAAGAGTGAATTAGTGTCAAGATTGGTGAGACATGGGCATACCCATACAAGTTCTAATTTTCCA
AGGCTATGTTAA