Details for Chinese cabbage Locus Brara.A02848

Position : A01 ( 5`- 24268745 .. 24270795 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02848

Protein [Map View]
MDVSARKSQKAGREKLRREKLNEHFVELGNVLDPERPKNDKATILTDTLQLLKELTSEVNKLKSEYTALTDESRELTQEK
NDLREEKTSLKSDIENLNLQYQQRLRSMSPWGAAMDHTVMMAPPPSFPYPMPMAMPPGSIPMHHPPMPSYTYFGNQNPSM
MPAPYMPYMPPNTVVEQQSVHIPQSNRSREPRTKVSRESRSDKAEDSNDVATQLELKTPGSTSDKDTSQRPEKSKRCKRN
SNNNNNNNSVEESSHSSKCSSSPSVRDNTSSSSVSGGGLKPDDAK*

DNA
ATGGACGTTTCAGCTAGAAAGTCTCAGAAAGCAGGCCGTGAAAAGTTGAGGAGGGAGAAACTGAATGAGCATTTTGTTGA
ACTTGGGAATGTGCTCGATCCAGAAAGACCCAAGAATGACAAAGCTACGATTCTCACTGATACTCTTCAGTTGTTGAAAG
AGCTCACTTCAGAAGTCAACAAACTCAAATCTGAGTACACCGCTTTGACAGATGAGTCCCGCGAGCTGACACAGGAGAAA
AACGACCTGAGAGAAGAAAAGACATCGCTCAAGTCAGATATAGAGAATCTCAATCTGCAATACCAGCAGAGATTAAGGTC
AATGTCTCCATGGGGAGCCGCAATGGATCACACTGTCATGATGGCTCCACCGCCTTCTTTCCCATACCCAATGCCAATGG
CTATGCCTCCCGGGTCAATCCCAATGCATCATCCACCAATGCCATCTTACACTTACTTTGGCAACCAGAATCCTAGCATG
ATGCCAGCGCCTTACATGCCCTATATGCCTCCTAATACCGTCGTTGAGCAACAGTCCGTGCACATACCACAGAGCAACCG
TTCCAGGGAGCCTAGAACAAAGGTTTCAAGAGAGAGCAGGTCCGATAAAGCAGAGGACTCTAATGACGTTGCAACACAGC
TAGAGTTGAAGACTCCTGGATCTACTTCTGACAAGGATACATCACAAAGGCCAGAGAAGAGCAAGAGATGTAAGAGAAAC
AGCAACAACAACAACAACAACAACTCTGTAGAAGAAAGCTCCCACTCAAGCAAGTGTTCATCTTCTCCGAGCGTCCGAGA
CAACACTTCTTCCAGTAGCGTATCTGGTGGTGGCCTAAAACCTGATGATGCAAAATGA